KEGG   Oenococcus oeni: OEOE_1612Help
Entry
OEOE_1612         CDS       T00408                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ooe  Oenococcus oeni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OEOE_1612
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OEOE_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1528128..1529150
Genome map
AA seq 340 aa AA seqDB search
MLDYLIDEVSKAFYLIFTNFILDKKEVDLVNKVIVLGSLNVDTILKIKRFPNPGETLETL
DKSSAAGGKGANQAVAAVRSGAQTTMIGQIGHDDLGKFMIDSLQNDHINVSPITVNDTVG
TGTATVLLDENGQNCILVYGGANQKISPEDIKKISDNIKNSDFLISQFETPQNATKAAFE
IAKENSLTTILNPAPASKIDSSLLTLTDLIVPNETESTVLTGIKITDEKSMIETAKAFSK
MGIDNLIITIGDRGVFYSTKEKSELVSAYHVKAVDTTAAGDTFIGALSSQLKKDLSNIKS
AISFAQCASSITVQRLGAQPSIPTLNEIRIAEKNYESVKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctagactatttaattgatgaagttagtaaagcgttttacttaatttttacgaatttc
atcttggataagaaagaggttgatcttgtgaataaggtaatagttttaggcagtttaaat
gttgatactattctaaaaataaagcgtttcccaaatcctggagaaacactagaaacttta
gataaaagctctgctgccggcggaaaaggagcaaatcaagccgtagccgccgtccgttca
ggtgctcaaacaacaatgattgggcaaatcggtcatgatgatttaggaaaattcatgatt
gactcgcttcaaaatgatcacatcaatgtttcgccgattacggtcaatgacacagtagga
actggcacagcaactgttttattagacgagaatggtcaaaattgcattttagtatatgga
ggcgcaaatcaaaaaataagtccagaagatattaaaaaaataagcgacaacatcaaaaat
tcggattttttaatatctcaattcgagaccccgcaaaatgctactaaagcagctttcgaa
atagcaaaagaaaatagtcttacaactattttgaatcctgcgccggcgtccaaaatcgat
tctagtttattaactttaaccgacttaatcgtgccaaatgaaacagaaagtacagtttta
accggcataaaaattaccgatgaaaagtcgatgattgaaaccgcaaaagcattttcaaaa
atgggtatcgataatttaattatcacaatcggcgatagaggggtcttttattctacaaaa
gaaaaaagtgaattagtatccgcatatcatgtcaaagcagttgatacaacagccgccgga
gacaccttcatcggcgcactaagttcgcagctgaaaaaagatttgtcaaacattaaatcc
gctatatcatttgctcaatgcgccagttcaataacagttcagcgactgggagcccaacct
tctattccaactctaaacgaaattagaattgcagagaagaactatgaaagtgttaaaaac
tga

DBGET integrated database retrieval system