KEGG   Oenococcus oeni: OEOE_1652Help
Entry
OEOE_1652         CDS       T00408                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OEOE_1652
   01230 Biosynthesis of amino acids
    OEOE_1652
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_1652
   00051 Fructose and mannose metabolism
    OEOE_1652
   00562 Inositol phosphate metabolism
    OEOE_1652
Enzymes [BR:ooe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OEOE_1652
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OEOE_1652
  Exosomal proteins of bladder cancer cells
   OEOE_1652
  Exosomal proteins of melanoma cells
   OEOE_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1572541..1573314)
Genome map
AA seq 257 aa AA seqDB search
MVHQLELPSSYLNYNGIMRKPIIIANWKMNFLRDQANLYVKKLIKKLGNKENIEVGIASQ
DLFLTDLIKLTENTPISIVAQNAYWENFGPFTGETSPKALANVGVDYVMLGHFERRELFN
ETNSTVNLKVRTALNNGMDVIVDVEELEQVAPVLEGVSEEQMQQIIIGFEPTFAIGTGMS
ASTKGAEDVAEQIRKTVRKLYGSDVADSTRILYGGSVNRDNLKSLIKQKDIDGVLVGKAA
LDFQSFWELVEIIENSL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggttcatcagttagagttacccagttcatatctcaactataatggaattatgcgaaaa
ccaattattattgcaaactggaagatgaattttttgcgcgatcaagctaatttatacgtt
aaaaagttgattaaaaagcttggtaacaaagaaaatatcgaagttggaattgcttctcag
gatctttttttaactgatttgattaaactaactgaaaatactcccatttcgatagttgct
caaaatgcttattgggaaaattttggtccctttacgggcgaaacttctcccaaagcatta
gccaatgttggggtagattatgtcatgcttgggcattttgaacgacgcgaactattcaac
gaaactaattcaactgttaatttaaaagttcggacagctttgaataacggtatggatgtg
attgttgatgttgaggagctggagcaggttgctccggtcctagaaggtgtttcagaagaa
cagatgcaacaaattatcatcggattcgaaccgacctttgcaattggaaccggaatgtca
gccagcactaagggtgccgaggatgttgccgaacaaattagaaagacggttagaaagctc
tatggaagcgatgtcgccgattcaacaagaattttgtatggcggatcggtgaatcgcgat
aatttaaaaagtttaatcaaacaaaaggatatcgatggtgttttagtcggtaaagctgct
ttggactttcaaagtttttgggaacttgttgaaattattgagaattcgctttaa

DBGET integrated database retrieval system