KEGG   Oenococcus oeni: OEOE_1779Help
Entry
OEOE_1779         CDS       T00408                                 

Definition
(GenBank) Glycosidase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
ooe  Oenococcus oeni
Pathway
ooe00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OEOE_1779
Enzymes [BR:ooe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     OEOE_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ABJ57618
JGI: OEOE1779
UniProt: Q04D54
Position
complement(1696317..1697786)
Genome map
AA seq 489 aa AA seqDB search
MPVKNKAMLITYSDSMGKNIKELQYILDKYIGDAIGGVHLLPFFPSTGDRGFAPSDYTRV
NPDFGDWEDVEELGKKYYLMFDFMINHISRESIMYQDFKEKKDASSYKDFFIRWEKFWPK
GRPTKADIDLIYKRKDKAPIQGITFADGSQEHLWNTFGDEQIDINVKSKVAQEFFKDTLQ
SMVKHGADLIRLDAFAYAIKKIDTNDFFIEPEIWDLLESVRKILDPLHAEILPEIYEHYT
IPAKINEYGYFTYDFVLPLVILYTLYSGNPKQLAKWLKMSPKKQFTTLDTHDGIGVVDAR
DILTDEEIDYTSSELYKVGANVKRTYSSAAYNNLDIYQINSTYYSALGNDDKAYLLARAI
QIFAPGIPQIYYAGLLAGENDLDLLEKTKEGRNINRHYYSEEEVANEVQRPIVACLLKLL
AWRNRSAAFDLQGDIQVSATDKNEIKIIRTSTNGQDTAELTANVALKTFTIKENDKIILI
EDQTDTKDI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccggttaaaaataaagcaatgctgatcacctattcggattcgatgggtaagaatatc
aaggaattacaatacattttagataaatatattggagacgcgattggtggagttcatctg
ctgcctttttttccgtcaaccggagatcgtggttttgcgccctcggattacactcgtgtc
aatccggatttcggtgattgggaggatgtcgaggaacttggaaaaaagtattatttaatg
tttgatttcatgattaatcacatttcccgtgaatcgattatgtatcaagatttcaaggaa
aaaaaggatgcttccagctacaaggacttttttattcgttgggaaaagttctggccgaaa
ggacgcccgacgaaggccgatatcgatttaatttacaaaagaaaagataaggcgccgatt
caggggattacttttgcagacggcagtcaagaacatctttggaatacttttggcgatgag
cagatcgatattaacgtgaagtccaaagttgctcaggaattttttaaagatactttacag
tcaatggttaagcacggtgcggatttgattcgcctggatgcctttgcttatgcaattaaa
aagattgatactaatgacttctttattgaaccggaaatttgggatttactggaatcagtt
cggaagattctcgaccccctacatgctgaaattttaccggaaatttatgaacattacaca
atcccggccaaaataaatgagtatggttactttacctatgattttgttttacctctggta
attttgtacactctttattctggaaatcccaagcaattggccaaatggttgaaaatgtca
ccaaaaaaacagtttacgactcttgatactcatgatggaatcggggttgttgatgctcgc
gatattttaactgatgaggaaatcgactatacttccagtgaactgtataaagttggtgcg
aacgtcaaacggacttattcatctgcggcctataataatttggatatttaccagattaac
tcgacctattattcagctcttggcaatgatgacaaagcctatttgcttgcccgtgcaata
caaatttttgccccgggaattccacaaatctattacgcaggcctgctggctggtgaaaac
gatttggatttgttggaaaagaccaaggaaggacgcaatataaatcgtcattattacagt
gaagaagaagttgccaatgaagtgcagagaccaattgttgcctgcctactgaaattgttg
gcttggcgcaatcgcagtgccgcttttgatcttcaaggagatattcaagtcagcgcaacc
gacaaaaatgaaatcaaaattattcgaacttcaaccaatggccaagacaccgcggaatta
accgctaatgtggctctaaaaacctttactataaaggaaaatgataaaattattttaatt
gaagatcagactgatacaaaggatatctaa

DBGET integrated database retrieval system