KEGG   Oenococcus oeni: OEOE_1779Help
Entry
OEOE_1779         CDS       T00408                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ooe  Oenococcus oeni
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ooe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1696317..1697786)
Genome map
AA seq 489 aa AA seqDB search
MPVKNKAMLITYSDSMGKNIKELQYILDKYIGDAIGGVHLLPFFPSTGDRGFAPSDYTRV
NPDFGDWEDVEELGKKYYLMFDFMINHISRESIMYQDFKEKKDASSYKDFFIRWEKFWPK
GRPTKADIDLIYKRKDKAPIQGITFADGSQEHLWNTFGDEQIDINVKSKVAQEFFKDTLQ
SMVKHGADLIRLDAFAYAIKKIDTNDFFIEPEIWDLLESVRKILDPLHAEILPEIYEHYT
IPAKINEYGYFTYDFVLPLVILYTLYSGNPKQLAKWLKMSPKKQFTTLDTHDGIGVVDAR
DILTDEEIDYTSSELYKVGANVKRTYSSAAYNNLDIYQINSTYYSALGNDDKAYLLARAI
QIFAPGIPQIYYAGLLAGENDLDLLEKTKEGRNINRHYYSEEEVANEVQRPIVACLLKLL
AWRNRSAAFDLQGDIQVSATDKNEIKIIRTSTNGQDTAELTANVALKTFTIKENDKIILI
EDQTDTKDI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccggttaaaaataaagcaatgctgatcacctattcggattcgatgggtaagaatatc
aaggaattacaatacattttagataaatatattggagacgcgattggtggagttcatctg
ctgcctttttttccgtcaaccggagatcgtggttttgcgccctcggattacactcgtgtc
aatccggatttcggtgattgggaggatgtcgaggaacttggaaaaaagtattatttaatg
tttgatttcatgattaatcacatttcccgtgaatcgattatgtatcaagatttcaaggaa
aaaaaggatgcttccagctacaaggacttttttattcgttgggaaaagttctggccgaaa
ggacgcccgacgaaggccgatatcgatttaatttacaaaagaaaagataaggcgccgatt
caggggattacttttgcagacggcagtcaagaacatctttggaatacttttggcgatgag
cagatcgatattaacgtgaagtccaaagttgctcaggaattttttaaagatactttacag
tcaatggttaagcacggtgcggatttgattcgcctggatgcctttgcttatgcaattaaa
aagattgatactaatgacttctttattgaaccggaaatttgggatttactggaatcagtt
cggaagattctcgaccccctacatgctgaaattttaccggaaatttatgaacattacaca
atcccggccaaaataaatgagtatggttactttacctatgattttgttttacctctggta
attttgtacactctttattctggaaatcccaagcaattggccaaatggttgaaaatgtca
ccaaaaaaacagtttacgactcttgatactcatgatggaatcggggttgttgatgctcgc
gatattttaactgatgaggaaatcgactatacttccagtgaactgtataaagttggtgcg
aacgtcaaacggacttattcatctgcggcctataataatttggatatttaccagattaac
tcgacctattattcagctcttggcaatgatgacaaagcctatttgcttgcccgtgcaata
caaatttttgccccgggaattccacaaatctattacgcaggcctgctggctggtgaaaac
gatttggatttgttggaaaagaccaaggaaggacgcaatataaatcgtcattattacagt
gaagaagaagttgccaatgaagtgcagagaccaattgttgcctgcctactgaaattgttg
gcttggcgcaatcgcagtgccgcttttgatcttcaaggagatattcaagtcagcgcaacc
gacaaaaatgaaatcaaaattattcgaacttcaaccaatggccaagacaccgcggaatta
accgctaatgtggctctaaaaacctttactataaaggaaaatgataaaattattttaatt
gaagatcagactgatacaaaggatatctaa

DBGET integrated database retrieval system