KEGG   Oenococcus oeni: OEOE_1781Help
Entry
OEOE_1781         CDS       T00408                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ooe  Oenococcus oeni
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    OEOE_1781
  Lipid metabolism
   00561 Glycerolipid metabolism
    OEOE_1781
   00600 Sphingolipid metabolism
    OEOE_1781
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     OEOE_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1699170..1701359)
Genome map
AA seq 729 aa AA seqDB search
MITFDENTKVFHLSNNQISYLMSVEEGNLLAHLYFGKRVGHYSGERLNPRFDRSFSGNLP
GSLDRTYSKDTLLQEWSGNNTGDYRAPAVIIRDENGARQTDFRFQSYKIIDGKPELKNLP
HAYVKDDSEAQTLIVNLLNENLACEVELSYSIYNDRPIIARSAKLINKGRHILHIEKIAS
MQIDFPKSDFQVISLPGAHARERQIERQTLHHGLTQFESRRGTSSHHMNPFIALIHPSTT
EFNDEAIGIQLVYSGNHQETLERDYIDQTRVLAGINQYDFDWKLRAGDSFQTPEALIVYS
SSGLNGMSQTYHRLLRERVARGKYQFAQRPIVINNWEATFFDFDTEKIQKILDNAAPLGI
EMFVLDDGWFGHRDDDNSSLGDWFEHATKLRGGLKALSQQVHDRKMKFGLWFEPEMISED
SELYKKHPDYALQVPGRGMTPSRGQYVLDFSRKEVVDNIFNQMTKILDNVDIDYVKWDMN
RHLTEVYSTELPADRQGEVSHRYVLGVYDLAQRITSRYPDILFEGCSGGGGRFDAGMLYY
FPQSWTSDNTDAVARLKIQYGSSLSYPVSSMTAHVSVSPNQQTGRQTSFEMRGDVAMAAV
FGYELNLADLSDKEKEIVKSQIKFYKKHRQLIQYGDFIRLKSPFDGNQTAWEFVSPDKKE
LLLYRYKLISQAQPEFTLTKLAALDPDKIYLADDKKRYAGDELMNIGLYDTPIQLADWTS
RVDYFQAEN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatcacatttgatgaaaacacaaaggtatttcatttatccaataatcaaatttcttat
ctcatgtcagttgaagaaggaaacctgcttgcccatctttattttggtaaaagagttggg
cattattctggagaaagattaaatccccgctttgaccgtagtttttccggcaatctgcct
ggttctttagatcgcacttattcaaaagatactttgttgcaggaatggtcgggaaataat
accggagattatcgagccccagctgtgattatccgcgatgaaaacggggcaagacaaaca
gattttcgttttcaatcttataaaataattgacggaaaaccggaattgaagaatcttccc
catgcttatgtcaaggatgattccgaagctcagactttgattgtgaatctattgaatgaa
aacttggcatgcgaagttgaactcagttatagcatctacaatgatcgacccattattgcc
cgcagcgcaaaattaattaacaaaggacgacatattttgcatattgaaaagattgccagt
atgcagattgattttccaaaaagcgattttcaagttatctcccttccaggcgctcacgcc
cgcgaacggcaaatcgaacggcaaacgcttcaccatggattgactcaatttgaaagtcgt
cggggtacctccagccatcatatgaatccttttattgctttgattcatccatcgacaact
gaatttaacgatgaagcgattggcattcaattggtttattccggaaatcatcaagaaacg
cttgaacgcgattatatcgaccagacacgggttcttgccggcattaaccagtatgatttt
gattggaagctaagagcgggtgactcctttcaaacaccggaagctctgattgtttattca
agtagcggcttaaacggaatgtctcaaacttatcatcgtctgctccgtgagcgcgttgct
cgtggaaagtatcaatttgctcagcggccaattgttattaacaattgggaagcaactttt
tttgatttcgataccgagaaaattcagaaaattttggataacgctgcgcccttgggaatt
gaaatgtttgtccttgacgacggttggttcgggcatcgggatgatgacaattcaagtctt
ggcgattggtttgaacatgcaacaaaactaaggggtggactgaaggccttgagccaacag
gtccatgacaggaaaatgaaattcggtctttggtttgaaccggaaatgatttctgaagat
tccgaattatataaaaaacatcctgattatgctttgcaggttcctggccgagggatgacg
ccttcgagagggcaatatgtattggatttttctcgaaaagaagtggtcgataatattttt
aatcaaatgaccaaaattcttgataatgttgatatagattatgtcaaatgggatatgaat
cgtcatttaacagaagtatattcaactgaattaccagctgatcgtcaaggcgaggtaagt
caccgttacgtgctgggtgtttatgatttggctcaacggattacttcccgatacccagac
attctttttgagggttgctctggcggtggcggtcgttttgatgccggcatgctttattat
tttcctcagtcctggacatctgataataccgacgccgtggcgcgtttgaaaattcaatac
ggtagttctttgtcttatccggtatcgagtatgacagcccatgtctctgtttctccgaat
caacagaccggtcgtcaaacgagttttgagatgcgcggggatgtggcgatggcggctgtc
tttggctatgaattgaatttagccgatttgtccgataaggaaaaagaaatcgttaaatcg
caaattaaattttataaaaaacatcgtcaactaattcagtacggagattttatcagatta
aaatcgccttttgatggaaaccaaacagcctgggaatttgtttcacctgataaaaaagag
ttgctgctttatcgttataaactaatttcccaagctcaaccggaatttactttgacaaaa
ttggccgctttggatcctgataagatttatctggctgatgataaaaaaaggtatgccggt
gatgaattgatgaatatcggtctttatgatacaccgattcaattggccgattggaccagt
cgagttgattattttcaagctgaaaattga

DBGET integrated database retrieval system