KEGG   Oenococcus oeni: OEOE_1831Help
Entry
OEOE_1831         CDS       T00408                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ooe  Oenococcus oeni
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ooe00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1751754..1753769
Genome map
AA seq 671 aa AA seqDB search
MDKILYGTAYYYEYLPTDRLAKDIEMMKKAHLNIVRIGESTWGTYEKQSGVFDFSPLDKV
LDAMGKAGISVIVGTPTYAIPTWLAREHPEIMVQQKEERLPYGARQIMDITSPAYLFYGE
RIIRKMLEHINEHPAIIGYQVDNETKSYGTSSSNVQAGFVKYIKKEFNNDIEKFNREFGL
DYWSNRINSWEDFPSMDGTINGSLGTEFAKYQRQLVTDYLKWQVNIVNEYKKSKQFVTHN
FDFEWRDYSYGIQPDVNHFDAAETLDFVGTDIYHPSQSKLTGTEISFAGDLIRSIKHKSY
LVLETQAQAFKDRVPYPGQLRLSAYSHIASGANMIEYWHWHSTHNSFETYWKGILNHDSQ
SNPIYEEIQKTGSELENISSSLVNLNIHADVCILVSNQSLTAINWFPFSENKNYNDIFRR
LYDPFYKLNIRTDISDENHIKPSDYKLIVVPSLYSVSDKVLEKLNDYVENGGHVIYMFKS
GFTDEHVKVRTSIQPAIIEKTAGVHYELFVTPDDLDAKLKPSLEGPISSDDNLHLDDWME
LLIPDSAKTLANYDHPVWKKYAAITENNYGKGQVVYIGCLPSENVINDLIKDQAEQLHLT
NKNSPKYPIVVKTAKNIKNENLTFYLNYSDKKQILPSQISKVDIFTNQVGKNFESIPPWG
VKIFKNKEKEV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggataagattttatacggaactgcttactattatgagtatttgccaactgatagatta
gctaaagacatcgaaatgatgaaaaaagcacatttaaatattgttcggattggcgagagc
acctggggtacttatgaaaaacagtccggagtatttgatttttcaccactggataaagtc
ctcgacgctatgggcaaagcaggtataagcgtcattgttggtactccaacatacgccatc
ccgacttggttggctcgggaacatcctgaaattatggttcaacaaaaagaagaacgtctt
ccgtatggtgccagacaaataatggatattacgagtcccgcctatcttttttatggagaa
cgaattattcgaaaaatgctggagcatattaatgaacacccagcaattatcggctaccaa
gttgataatgaaacaaagtcttatggtacatcgagctcaaatgttcaggcagggtttgtt
aaatatattaaaaaagaattcaacaacgatatagaaaaattcaaccgtgaatttggtctc
gattattggagcaaccgtataaatagctgggaagatttcccatctatggacgggaccatt
aatggatcattgggaacggaatttgctaaatatcagaggcaacttgtgactgattatctt
aagtggcaagtaaatatcgttaacgaatataagaaaagcaagcagttcgtaacacataat
tttgattttgaatggcgtgattactcatatggaattcaaccggatgtgaatcatttcgat
gcagcggaaacactcgacttcgtcggaacggatatttatcatccatcgcaatcaaaactt
acaggtacagagatatcctttgccggagatttaatcagaagtattaagcacaaaagttat
ctcgttttagaaactcaagctcaagcttttaaagacagggtaccttaccccggccagtta
cgtctatcagcctatagccatattgcttccggtgcaaacatgatcgaatactggcattgg
cactcaactcacaattcctttgaaacttactggaaaggaatcctgaaccatgattcccaa
tccaatccgatttatgaagaaatccaaaaaaccggtagcgaacttgaaaatatttcttcc
tcgcttgttaatttaaacatccatgcagatgtttgtatcttggtttccaatcaatcacta
actgcaattaattggtttccattttccgaaaacaaaaactacaacgatatttttcgtcgt
ttgtatgatccgttttataaattaaatatcagaacagatatcagtgacgaaaatcatatt
aaaccaagcgattataaattaattgtcgttccatctctgtatagcgtcagcgataaggtt
ttggaaaagttaaacgattatgtcgaaaatggcggacacgttatttatatgttcaaatcc
ggttttaccgacgaacatgttaaggtccggacatcgattcaaccggcaattatcgaaaaa
acagccggagtccattacgaattgtttgttactccagacgatctggatgccaaattaaaa
ccatcgcttgagggaccaatctccagtgatgacaacttacatctcgacgattggatggaa
ctgcttattcctgattctgcaaaaaccttggctaattacgatcatcctgtttggaaaaaa
tatgcggccatcaccgaaaataactacggcaaaggccaagttgtctatatcggctgctta
ccatccgaaaacgtcatcaacgatttaataaaggatcaagccgagcagctgcatcttaca
aataaaaattcgccaaagtacccaattgttgtgaaaacggcaaaaaatataaaaaatgaa
aatctaactttttatttaaattattccgacaaaaaacaaattttgccttcgcaaattagt
aaagtcgacattttcacaaatcaagttggaaaaaattttgaaagcattcctccttggggt
gtaaaaatttttaagaacaaggaaaaagaggtttga

DBGET integrated database retrieval system