KEGG   Oceanithermus profundus: Ocepr_0084Help
Entry
Ocepr_0084        CDS       T01369                                 

Definition
carbohydrate kinase, fggy
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
opr  Oceanithermus profundus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ocepr_0084
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ocepr_0084
Exosome [BR:opr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ocepr_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(72853..74286)
Genome map
AA seq 477 aa AA seqDB search
MHRPETETAFLVVDQGGHASRAIVFDARGRPLAAAARAIRARRPDELRAEYDGAALWAQV
AAAVREALAAAPGPLAAAGLATQRSNVACWDRHSGEPLGPVISWQDRRAWRAVEALRARE
AWIHERTGLFLTPHYGASKLRWCLERLPEVRRAHEEGRLGFGPMAAWLAGRLAGGAARAA
DVVNASRTQLVALETRDWDEELLRLFGVPRDPLPPVVPNAWGYGSLEAAPEVPLALVTGD
QNAALFAYGELDEATAYVNAGTGTFVLRTTGSRRVRAGRLLSGVLHEGGGRVEYVLEGTV
NGAGSALAWFERTYGVEDLTGRLEGWLAQVPVSPLVFLNGVSGLGSPFWRARFPVRFEGE
GGLAEKAAAVVESIVFMLAVNLEEQARYLPAPRRVRLTGGLANLDGLAQRLADLTGLVVE
RPPELEATARGAAFLLAGRPADWEPGGAPDVFEPRANPGLEANYARWRAAVERELGR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggcccgagaccgagaccgccttcctggtcgtcgaccagggcgggcacgccagc
cgcgccatcgtcttcgacgcccgcggacggccgctcgccgcggcggcgcgcgcgatccgc
gcccgccggcccgacgagctgcgggccgagtacgacggcgcggcgctctgggcgcaggtc
gccgcggcggtgcgcgaagcgctcgccgccgctcccggcccgctcgccgcggccggcctg
gccacccagcgctcgaacgtggcctgctgggaccggcacagcggcgaaccgctgggcccg
gtgatcagctggcaggaccgccgtgcctggcgcgcggtggaggcgctgcgcgcgcgcgag
gcctggatccacgagcgcaccggcctcttcctgacgccccactacggcgccagcaagctg
cgctggtgcctggaacgcctgcccgaggtgcgccgggctcacgaggagggccggctgggc
ttcgggcccatggccgcctggctcgcggggcggctggcgggcggggcggcccgcgccgcc
gacgtggtgaacgccagccgcacccagcttgtggccctggaaacgcgcgactgggacgag
gagcttttgcgcctcttcggcgtgccgcgggacccgctgccgccggtggtgcccaacgcc
tggggctacggatcgctggaggccgcgccggaggtgccgctggcgctcgtcaccggcgat
cagaacgccgccctcttcgcctacggcgagctggacgaggccacggcctacgtcaacgcc
ggcaccggcaccttcgtgctgcggaccaccggcagccggcgggtgcgggccgggcggctg
ctctccggggtgctgcacgaaggcggggggcgggtggagtacgtgctcgagggcacggtc
aacggcgccggctcggcgctggcctggttcgagcgaacctacggggtggaggacctgacg
ggccggctggagggctggctggcgcaggtgccggtgagcccgctcgtcttcctgaacggc
gtttccgggctggggtcgcccttctggcgggcgcgcttcccggtgcgcttcgagggggag
ggcggcctggccgagaaggcggcggccgtggtggagagcatcgtcttcatgctggccgtc
aacctggaggagcaggcccgctacctgcccgcgccgcggcgcgtccgccttaccggcggc
ttggcgaacctggacgggctggcccaaaggctcgccgacctgacggggctcgtggtggag
cggcccccggagctcgaggcgacggcccggggggcggccttcctgctcgccggccggccg
gcggactgggaaccgggcggcgcgcccgacgtcttcgagccgcgcgcgaacccggggctc
gaggcgaactacgcccgctggcgggcggcggtggaacgggagctggggcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system