KEGG   Oceanithermus profundus: Ocepr_0122Help
Entry
Ocepr_0122        CDS       T01369                                 

Definition
(GenBank) peptidase M42 family protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
117525..118583
Genome map
AA seq 352 aa AA seqDB search
MKPELNLNFFEELLGAVGPSGFEDEAARVWVREAETFADEVWRDAHGNSYARIRPGGSPR
IMLAGHIDEIGLIVTHVSDEGFVYVEPLGGWDPQVLVGQRVRFLGRKGQVLGVVGRKPIH
ALEPDERGKAVKLKDVWIDVGAADKKEALEALEVGSVGVIDQPLRYLMGRRVVSRAIDNR
IGAFVALEALRRAQELGGEAEVVAVATVQEEIGAWGARTAAFRLEPDTALVVDVTHCSRQ
PGVDPKRHGEVALGKGPSLAVGPYAHPGVLARLRALAAEHGIPYVLEAHGRWSGTDADEI
AVTREGVPAAVVSVPNRYMHSPSEMIDLGDVEHTVELMARYAAAPLTELVRK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggaactgaacctcaacttcttcgaagaactcctgggcgcggtggggccgagc
ggcttcgaggacgaggccgcgcgcgtctgggtgcgcgaggccgagaccttcgccgacgag
gtctggcgcgacgcccacggcaacagctacgcccgcatccgccccggcgggagcccgcgc
atcatgctggccgggcacatcgacgagatcggcctgatcgtcacccacgtctccgacgag
ggcttcgtctacgtcgaacccctggggggctgggacccgcaggtgctcgtgggccagcgg
gtgcgctttctaggcaggaaggggcaggtgctgggcgtggtggggcgcaagcccatccac
gccctagagcccgacgagcgcggcaaggcggtgaagctgaaggacgtctggatcgacgtc
ggcgccgcggacaagaaggaggcgctggaggcgctcgaggtgggcagcgtgggcgtgatc
gaccagccgctgcgctacctgatggggcggcgggtggtgagccgcgccatcgacaaccgc
atcggcgccttcgtggcgctcgaggcgctgcgccgggcccaggagctgggcggcgaggcc
gaggtggtggccgtggccacggtgcaggaggagatcggggcctggggcgcgcgcaccgcc
gccttccggctcgagcccgacaccgcgctggtggtggacgtgacccactgcagccggcag
cccggggtggaccccaagcggcacggcgaggtggccctgggcaaggggcccagcctggcc
gtggggccctacgcccacccgggggtgctggcgcggctgcgggcgctggccgcggagcac
gggatcccctacgtgctcgaggcccacggccgctggtcgggcaccgacgccgacgagatc
gccgtcacccgcgagggcgtgcccgccgcggtggtgagcgtgcccaaccgctacatgcac
tcgccttccgagatgatcgacctgggcgacgtcgagcacaccgtggagctgatggcccgc
tacgccgcggcgccgcttacggagctggtgcggaagtga

DBGET integrated database retrieval system