KEGG   Oceanithermus profundus: Ocepr_0207Help
Entry
Ocepr_0207        CDS       T01369                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
opr  Oceanithermus profundus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_0207
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ocepr_0207
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Ocepr_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201192..202901
Genome map
AA seq 569 aa AA seqDB search
MTRRWWTVDLNRRSLTERRLGPEEVLRGGRWRTVHELQRLGAAGADPLAPDNPVVLAAGP
FAGSSYSNANRLSVGTRSPLTGGVKEANSGGTLAYALGRIGVAGLTLVGAAPDWVVLVLG
PDGVRFADAAPYLGLGNYAAAEHLWNDFPAAASLALVGPVAEYGGLLAGLAVTDTDGQPG
RLAARGGVGAVFGAKRVKAIVVEEGASPAFAGDAAFKDAMRAYARALLASDGIKRYTSVG
TAGMGDFQNMFGGLPVKNFSRGRLAEGENPLGGEALRRLILERDGEGATAHACMPGCVIR
CSNKVPDAWGKVVVSPLEYETLGLVGSNLGFDDLDAVARMNRWANDLGVDTIEFGAALGV
AMDAGLGPWADLDFVEDVYRALLAGTEEGRRYAAGAARLGRALGHARVPVVRDQGISAYD
PRVVEGTGVTYMTTPQGADHTAGNVPRENPGERSLEELMDLSFAAQVNAAASDALGLCIF
GGSVTYAQKDAAVRAAALAAGLDEEPDAAAFDRLGREVLALELAFNRAAGQPEVAPLPRF
MYEEPLPPRNLTARLDPERIAGFWKRLER
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcgttggtggaccgtcgacctgaaccgccgttcgctgaccgagcgccggctc
gggccggaggaggtgctgcgcggggggcgctggcgcacggtgcatgagctgcagcgcctc
ggggcggccggcgcggacccgcttgctccggacaaccccgtcgtgctcgccgccggcccc
ttcgccggctccagctactccaacgccaaccgcctcagcgtgggcacccgcagtccgctg
accgggggtgtcaaggaggccaactcggggggcacgctcgcctacgcgttggggcggatc
ggcgtcgccgggctcaccctcgtgggtgcggctccggactgggtggtgctggtgctgggc
ccggacggggtgcgcttcgcggacgccgcgccctacctggggctgggcaactacgcggcc
gccgagcacctgtggaacgactttcccgcggccgccagtctggccctcgtcggaccggtg
gccgagtacggagggctgctggccggcctcgccgtcaccgacaccgacggccagccgggt
cggctcgcggcccgcggcggcgtgggcgccgtcttcggcgccaagcgcgtcaaggcgatc
gtcgtggaagagggcgcgtcccccgccttcgccggcgacgccgccttcaaggacgccatg
cgcgcctacgcgcgggcgctgctcgcgagcgacggcatcaagcgctacaccagcgtgggc
accgcggggatgggcgacttccagaacatgttcggcggcctgccggtgaaaaacttctcg
cgcggccgcctggccgagggggagaacccgctcggcggcgaggcgctccggcggctcatc
ctggagcgcgacggcgagggggccacggcgcacgcctgcatgccgggctgcgtgatccgc
tgctccaacaaggtgcccgacgcctggggaaaggtggtggtcagcccgctcgagtacgag
accctgggtctggtgggcagcaacctgggcttcgacgacctcgacgccgtggcccggatg
aaccgctgggccaatgacctgggcgtcgacaccatcgagttcggcgccgccctgggggtg
gccatggacgcgggcctgggcccctgggccgacctggacttcgtcgaggacgtctaccgc
gccctgctcgcgggcacggaggaggggcggcgctacgcggcgggggccgcgcggctcggc
cgcgcgctcgggcacgcgcgcgtcccggtggtgcgcgaccagggcatcagcgcctacgac
ccgcgcgtcgtcgagggcaccggcgtgacctacatgacgacgccgcagggggcggaccat
accgcgggcaacgtcccccgcgaaaaccccggcgagcgcagcctcgaagagctgatggac
ctgagcttcgccgcccaggtgaacgccgcggcttcggacgcgctggggctgtgcatcttc
gggggcagcgtcacctacgcgcagaaggacgccgccgtgcgcgccgcggcgctggccgcg
ggcctggacgaggagccggacgcggccgccttcgaccggctaggccgcgaggtgctggcc
ctggagctcgccttcaaccgcgccgccggccagcccgaggtggccccgctgccgcgcttc
atgtacgaagagccgctgccgccgcgcaacctcaccgcgcggctcgatcccgagcggatc
gccgggttctggaaacggctcgagcgctag

DBGET integrated database retrieval system