KEGG   Oceanithermus profundus: Ocepr_0358Help
Entry
Ocepr_0358        CDS       T01369                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
opr  Oceanithermus profundus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(352006..352689)
Genome map
AA seq 227 aa AA seqDB search
MNPVLLIHGFTSHPTRVWGPLPEILEERGFAVRFVTLAGHGTRPEDLRGVRADDWLRQVR
DAAADLEDYALVGLSMGALLAAALAAERPPRALVAAVPALGLGNPLVPLVPYLTWLLPRL
PGTDSIEDPELKAQNPNYPHFPSPALVELLALVRRTPAWLRSVRAPALVVRAEGDKVIAR
TAVRRYLEGLASEDKELVTVRGGHDFLLDRHAREGAERIAGWLAQRA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccggtactgctcatccacggcttcacctcgcacccgacgcgggtctggggtccc
ctgcccgaaatcctcgaggaacgcggcttcgcggtgcgtttcgtcaccctcgcggggcac
ggcacccgccccgaggacctgcggggggtgcgcgccgacgactggctccgccaggtgcgg
gacgccgctgcggacctcgaggactacgcgctcgtcggcctctcgatgggggccctgctg
gcggcggcgctggccgcggagcggccgccgcgcgcgctggtggccgcggttcccgccctg
gggctcgggaacccgctggttcccctggtgccctacctgacctggctgctgccgcgcctg
cccggcaccgactcgatcgaggacccggagctgaaggcgcaaaaccccaactacccgcac
ttccccagcccggcgctggtggagctgctcgcgctcgtccgccgcacgccggcctggttg
cggtcggtgcgcgcgccggccctggtggtgcgggcggagggggacaaggtcatcgcacgc
acggcggtgcgccgctacctcgaggggctggcgtcggaggacaaggagctcgtcaccgtg
cgcggcggccacgacttcctgctcgaccgccacgcccgcgagggggcggagcggatcgcc
ggctggctcgcgcagcgggcctag

DBGET integrated database retrieval system