KEGG   Oceanithermus profundus: Ocepr_0492Help
Entry
Ocepr_0492        CDS       T01369                                 

Definition
(GenBank) cytochrome c oxidase, subunit II
  KO
K02275  cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
opr  Oceanithermus profundus
Pathway
opr00190  Oxidative phosphorylation
opr01100  Metabolic pathways
Module
opr_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Ocepr_0492
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Ocepr_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cytochrom_C Cytochrome_CBB3 COX2_TM Cytochrom_C550 DUF1467 Cytochrom_C1 Cytochrome-c551 Phage_holin_3_6 RCR
Motif
Other DBs
NCBI-ProteinID: ADR35951
UniProt: E4U678
Position
complement(495264..496286)
Genome map
AA seq 340 aa AA seqDB search
MPRMLLSVGYLSLAGAALAHNVTILSDAPVNQEITGLLWWVLIFAVIIFGVVAGALAYTI
WKFRAKPGDDELPPQVHGNDRMEIIWTAIPLLIVMVLFVLTAQTLVKIKRPVAGSLPIEA
TGWQFWWDFQYPDEGLRTAGELVIPVGQPIEVKITSGDVIHSFWPPSLTGKADAVPGEDN
YLRFMATKPGNYYGYCAELCGASHANMRFRILALEREDYTRFIEAFKAYEAPAPANERVA
RGQQLFNAQCAACHAVKGTPARGVIGPDLSLFGMRTTLGSGVWDNTPENLKRWIQDSSAM
KPSSKMPPFTQLSDADLEALAAYLYSLKLDGFDFAQLPRY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaatgctattaagcgtgggctacctgtcgctggcgggtgccgccttggcgcac
aacgtcacgattctctcggacgccccggtaaaccaggagatcaccggcctgctctggtgg
gtgctgatcttcgccgtcatcatcttcggcgtcgtcgccggagcgctggcctacacgatc
tggaagttccgcgccaagccgggcgacgacgagctcccgccccaggtgcacggcaacgac
cgcatggagatcatctggacggccatcccgctgctcatcgtgatggtgctcttcgtcctc
accgcgcagacgctggtgaagatcaagcgtccggtggcgggctcgctgccgatcgaggcc
acgggctggcagttctggtgggacttccagtaccccgacgaggggctgcgcaccgccggg
gaactggtcatcccggtcggccagcccatcgaggtcaagatcacctcgggcgacgtcatc
cactcgttctggccccccagcctgaccggcaaggccgacgcggtgcccggggaagacaac
tacctgcgcttcatggccaccaagccggggaactactacggctactgcgccgagctctgc
ggggcctcgcacgcgaacatgcgcttccgcatcctcgcgctcgagcgcgaggactacacg
cgcttcatcgaggccttcaaggcctacgaggcccccgcgcccgcgaacgaacgggtggcc
cggggccagcagctcttcaacgcccagtgcgccgcctgccacgccgtcaagggcacgccc
gcccgcggcgttatcggacccgacctctccctcttcggcatgcgcacgacgctggggtcg
ggcgtatgggacaacaccccggagaacctcaagcgctggatccaggattcgtcggcgatg
aagccaagttcgaagatgccccccttcacccagctctcggacgccgaccttgaggcgctc
gcggcctacctctactcgctcaagctggacggcttcgacttcgcccagctgccgcgctat
taa

DBGET integrated database retrieval system