KEGG   Oceanithermus profundus: Ocepr_0530Help
Entry
Ocepr_0530        CDS       T01369                                 

Definition
(GenBank) hypothetical protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilN
Motif
Other DBs
NCBI-ProteinID: ADR35988
UniProt: E4U6Y5
Position
533995..535197
Genome map
AA seq 400 aa AA seqDB search
MAELYCTARTLFLYTTELIEHPLEGVISGGEPDYEHLVAEVRGFLRAQRVRGPLYLGLSS
EFLLLRTALFPVLEGFPLAEAVLAEAERSPFWGQHDLTIDYELLDTVDEHRRRVLFAAMP
AQAVAALTRRLRPRRLEPLPLAIWRASRSQFEGRESWIVLETLTNSMALFEQGRLTDFRQ
LAHPLAEGGQALVDEVVRSLQLFGRYEPVEAAWLFGLPEPPPAPEGLPAQEVVQSAQPGV
LKAAAWRREPPGLDLRPRRRRLGEGLPREAQRALLWSSFWLALGVSGYAVLNAQLQGQRS
INEGLRRDIARLEAVRPEEQEPLPEGVTTGLLERVSGALPEGTWLDGIQVDEFKLVLRGH
ALDPRAPQVLARRLEAPPAWTQWDEEGEDFAWEVSLELPQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctctattgcaccgcgcgtacgctgttcctctacacgaccgagctgatcgag
caccccctcgagggcgtgatcagcggcggcgaacccgactacgaacacctggtcgcggag
gtgcgggggttcttgcgggcgcagcgcgtgcggggccccctctacctgggcctttccagc
gagttcctgctgctacggaccgcgctctttcccgttctcgagggctttccgctggccgag
gcggtgctggccgaggccgaacgcagcccgttctggggtcagcacgacctcacgatcgac
tacgaactgctggacaccgtcgacgaacaccgccgccgcgtcctcttcgcggcgatgccg
gcgcaggccgtggccgcgctgacccggcgcctgcgcccccgccggctcgagcccctgccg
cttgcgatctggcgggcctcgcggtcgcagttcgaaggccgcgagagctggatcgtgttg
gagacgttgaccaacagcatggcgctcttcgagcagggccggctcaccgactttcgccag
ctcgcccaccccctggccgagggcgggcaggcgctggtcgacgaggtcgtgcgctcgctc
cagctcttcggccgctacgagccggtggaggcggcctggctgttcgggcttcccgagccg
ccccccgcccccgaggggcttcccgcgcaagaggtcgtgcagtcggcccagccgggggtg
ctgaaggccgccgcctggcgccgggagccgcccggcctcgacctgcgtccgcggcggcgc
cggctgggggaggggctgccgcgcgaggcccagcgggcgctgctgtggtcttcgttctgg
cttgcgctgggcgtctctggctacgcggtgctgaacgctcagctgcaggggcagcggtcg
atcaacgagggcctgcggcgggacatcgcccggctcgaggcagttcgccccgaagagcag
gagcccctgcccgagggcgtgaccaccgggctgctggagcgggtgagcggcgcgctgccc
gaggggacctggctcgacggcatccaggtcgacgagttcaagctggtgcttcgcgggcac
gcgctcgacccgcgcgccccccaggtgctggcgcgccggctcgaggccccgcccgcctgg
acccagtgggacgaagagggcgaggacttcgcctgggaggtgagccttgagctaccgcag
taa

DBGET integrated database retrieval system