KEGG   Oceanithermus profundus: Ocepr_0564Help
Entry
Ocepr_0564        CDS       T01369                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ADR36022
UniProt: E4U719
Position
563205..564461
Genome map
AA seq 418 aa AA seqDB search
MSLRLRIALGTAAIAAVAAGLHFVVGYLSFSELLREDIQRDLEVWSGAVAGTLVFQQGRP
ALAGSDWPWVSAGGSLGFRVRKGNVIYIEGGVLPEAQDPNWVWTEKPLQDGYVLEVVAYV
GEYRKALAGQLRAGLVSLPLVVLLASGLGWWLAGRIARPIGQLSDAADALSSMRFPDPVP
PPPGGDELSRLARSFNRMVYAVREALERERAFTRYASHELRTPLATMQAQLEALEAGLTP
QERALPEARKAIERMRGILEGLLTLSREPQVTLEPLPAGAVLRSLVGGLGEAARRVRLDL
PDEEVWVVGDEELLRRAVGNLIDNALKYSEGPVEVRLAAEGGEAVLSVRDHGDGVAEDQL
ERLADPFVRFHTRVAGTGLGLSLSKQAARAMRGRLGFEPARPGLRAWLRLPLVEDADA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgaggctgcgcatcgctctgggcaccgcggccatcgccgcggtggctgcgggg
ctgcacttcgtggtcggctacctcagcttctcggagctgttgcgcgaggacatccagcgc
gacctcgaggtctggtcgggggcggtggccggcaccctggtcttccagcaggggcggccg
gcgctcgcgggctccgactggccctgggtgagcgccggcggttcgctgggcttccgcgtg
cgcaagggcaacgtcatctacatcgaaggcggggtgctgcccgaggcgcaggacccgaac
tgggtctggacggagaagcccctgcaggacggttacgtgctcgaggtggtggcctacgtg
ggcgagtaccgcaaggcgctggcggggcagctgcgggcgggcctggtgagccttccgctc
gtcgtcctgctcgccagcggcctgggctggtggctcgcggggcgcatcgcccgccccatc
ggccagctctccgacgcggccgacgcgctctcgtcgatgcgctttcccgacccggtgccc
ccgccgccgggcggcgacgaactctcgcgcctggcgcgcagcttcaaccggatggtctac
gcggtgcgcgaagcgctggagcgcgagcgcgccttcacccgctacgcttcgcacgagctg
cgcaccccgctggccacgatgcaggcgcagctcgaggccctggaagcggggctcacccct
caggagcgggcgctgccggaggcgcgcaaggcgatcgagcggatgcgcggcatcctggaa
gggctgctgacgctgagccgcgagccccaggtgacgctcgagcccctgcccgcgggcgcg
gtgctgcgctcgctggtcgggggcctgggcgaggccgcacggcgcgtgcgcctcgacctg
cccgacgaggaggtctgggtcgtgggcgacgaagagctcctcaggcgcgccgtcggcaac
ctgatcgacaacgcgctcaagtacagcgagggaccggtggaggtccgcctggccgccgag
gggggcgaggccgtcctcagcgtgcgcgaccacggcgacggcgtcgccgaggaccagctc
gagcgcctggccgaccccttcgtgcgctttcacacccgcgtcgcgggcaccggcctgggg
ctttcgctttccaagcaggcggcccgtgccatgcgcggccgcctcggcttcgagccggcg
cggccggggctccgcgcctggctgcgcctgccgctcgtggaggacgccgatgcctag

DBGET integrated database retrieval system