KEGG   Oceanithermus profundus: Ocepr_0565Help
Entry
Ocepr_0565        CDS       T01369                                 

Definition
(GenBank) hypothetical protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADR36023
UniProt: E4U720
Position
564454..565212
Genome map
AA seq 252 aa AA seqDB search
MPRWMRALAAALLLARLLPGGALAAGAPDAAAPAYAADAGPQTDAAGPVLNDDDDDGGDD
GGGGGHDDDGSDDGHEDGSGSDDGHEDDGHETYDRQYSFYGQVRWSGERTIVGNRELVGD
DPWLPYLAPGMRLEVKGEAQGSRILVTEIEIKYPTAWAYYLGPAQVIGLEGGWIRAWLSG
SAGRDLFKLLPAAGETTPVLVACYERGSWRSVPLGLRPDARPPTDGWWRLSGRLSGSGVS
WTLAGRLPGDCD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggtggatgcgcgccctcgccgccgcactgttgctggcgcgcctgctgcccggc
ggggcgctggccgccggcgcgcccgacgcggcggcccctgcgtacgccgccgacgccggg
ccgcagacggacgccgcggggcccgttctgaacgacgatgacgacgacggcggcgacgac
ggcggtggcggcggccacgacgacgacggatccgacgacggccacgaagacgggtcgggc
agcgacgacggccacgaagacgacgggcacgagacctacgaccgccagtacagcttctac
gggcaggtccgctggtcgggcgagcgcaccatcgtgggcaaccgcgagctcgtcggagac
gacccctggctgccctacctggcgccgggcatgcggctcgaggtcaagggcgaggcccag
ggcagccgcatcctcgtcaccgagatcgagatcaagtacccgacggcctgggcctactac
ctgggcccggctcaggtgatcggcctcgagggcggctggatccgcgcctggctctcgggc
tcggcggggcgcgacctcttcaagctgctgcccgcggccggcgaaaccaccccggtgctg
gtggcctgctacgaacgcggcagctggcgttcggtgccgctcggcctgcgccccgacgcc
cgcccccccaccgacggctggtggcggctttccggccgcctcagcggctccggggtctcc
tggacgctcgccggccggttgccgggcgactgcgactga

DBGET integrated database retrieval system