KEGG   Oceanithermus profundus: Ocepr_0566Help
Entry
Ocepr_0566        CDS       T01369                                 

Definition
(GenBank) Propeptide PepSY amd peptidase M4
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Keratin_2_head
Motif
Other DBs
NCBI-ProteinID: ADR36024
UniProt: E4U721
Position
565273..565980
Genome map
AA seq 235 aa AA seqDB search
MKKTTYILTAVLGLTALALVFAQGMMGGYGYPQGSGYGYGSGGYGMMGGYGDASPWGGPG
YGMGMGMGGYGMGGMMMGGVYLPDARPLAEDEAKARLQSFVDRFAPGAQVRDLMAFSQNY
YAQIVDKDGRGLGEVLVDRYTGAVYPEPGPNMMWNRGPAGWGVPARYDLEAAKQLAENFL
DGFLPGARIMEEQAFSGYYTFDFGRDGIEGMLSINAYTGEVWVHSWHGPFLGEDE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgacctacatcctcacggcggtactcggactcacggcgctggctctggtc
ttcgcgcagggcatgatgggcggctacggctacccgcagggttcgggctacggctacggc
agcggcggttacggcatgatgggcggttacggcgacgcctcgccctggggcggacccggc
tacggcatgggcatgggcatggggggctacggcatgggcggcatgatgatgggcggcgtc
tacctgcccgacgcacgcccgctggccgaggacgaagccaaggcgcggctgcagtccttc
gtggaccgcttcgccccgggggcgcaggtccgcgacctcatggccttctcgcagaactac
tacgcccagatcgtggacaaggacggccgcggcctgggtgaggtgctggtcgaccgctac
accggcgcggtctaccccgaacccggccccaacatgatgtggaaccgcgggcccgcgggc
tggggcgtgccggcgcgctacgacctggaggccgcgaagcagctggccgagaacttcctg
gacggcttcctgccgggcgcgcggatcatggaggagcaggccttctcgggctactacacc
ttcgacttcggccgcgacggcatcgagggcatgctctcgatcaacgcctacacgggcgag
gtctgggtgcacagctggcacggccccttcctcggggaagacgagtag

DBGET integrated database retrieval system