KEGG   Oceanithermus profundus: Ocepr_0571Help
Entry
Ocepr_0571        CDS       T01369                                 

Definition
(GenBank) hypothetical protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bact-PGI_C
Motif
Other DBs
NCBI-ProteinID: ADR36029
UniProt: E4U726
Position
complement(570660..571547)
Genome map
AA seq 295 aa AA seqDB search
MRNLDAHEDYKVDERQLHRDLTGLVGSFPAPREAYPAPYGVVGFGEAWWPAELAHLWIPR
LMTEGGTQFVLQGGLDLGAAAGAVAAAEASGARVVRVGFGDAVDVPVEPHPLSPYRYLRF
LQEATGEAEAGTRVDRALEALAAGLAPEVPTEDNPAKFFAWNLIERIPVWVVSERYRGLA
AALQQTFARIAGSLSIAPPPGSLEFFITALEARHEQGDPLAAVVVGEDERTRLAVEILET
RVDTVLELPEPPAEGLIPEMMAAWYFVAWASYYLAILYGRNPADAEVLARLREEA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacctcgacgcccacgaggactacaaggtcgacgaacggcagctgcaccgggac
ctcaccgggttggtgggcagcttccccgccccccgcgaggcctaccccgccccctacggg
gtggtcggcttcggggaggcctggtggcccgcggagctggcccacctctggatcccccgg
ctgatgaccgagggcggcacccagttcgtgctgcagggcgggctcgacctgggggcggcc
gccggtgcggtggccgcggccgaggccagcggcgcgcgggtggtgcgcgtgggcttcggc
gacgcggtggacgtgccggtggagccccacccgctcagcccttaccgctacctgcgcttc
ctgcaggaggccacgggcgaggccgaggcgggaacccgtgtggatcgcgccctcgaagcg
ctggccgcggggctggcgcccgaggtgcccaccgaggacaaccccgccaagttcttcgcc
tggaacctgatcgaacgcatccccgtctgggtggtctccgagcgctaccgcgggctggcg
gccgcgctgcagcagaccttcgcccgcatcgccggcagcctctccatcgccccgccgccg
ggaagcctcgagttcttcatcaccgcgctggaggcgcggcacgagcagggcgacccgctg
gccgcggtggtggtgggcgaggacgagcgcacccgcctggccgtcgagatcctggaaacg
cgagtggacaccgtgctcgagcttcccgaacccccggccgaggggctgatccccgagatg
atggccgcctggtacttcgtcgcctgggcttcgtactacctggccatcctctacggccgc
aaccccgccgacgccgaggtgctggcgcggttgcgcgaagaggcgtga

DBGET integrated database retrieval system