KEGG   Oceanithermus profundus: Ocepr_0592Help
Entry
Ocepr_0592        CDS       T01369                                 

Definition
(GenBank) protein of unknown function DUF58
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58
Motif
Other DBs
NCBI-ProteinID: ADR36050
UniProt: E4U747
Position
590552..591652
Genome map
AA seq 366 aa AA seqDB search
MSLALLLLAFAAAALWVALPGLAPGRQRVRTARPYGAAGRERPLELEVGFVLPLPAYWRV
EWSPATRLGFRGRQVAGLGWGRVRLRLEATLQPRRRGEYELPGARLFVRDFLGIYEREVR
LEGPRERLFVYPRIWEQLPPQLALTLLAEGPESPELGLEDAGRYRGTREYRPGDALRRMH
WKATARQGRPMVREFAWVRATGVWIYIDVRGGEVYIDHMAELAASLAVRLMDLGLAVGLA
WPGFERPPARGLEALRGMLAALARLEPARAGGAPPLPPPGVNLVVFTQDAPPELIEGALA
ARARAARVHLLAFPEGFFLRPGEKGRPIWGRTDGMARLQERRGLLHAAGVHVHVFRGDEA
VRFTRA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctcgccctgctgctgcttgcgttcgccgccgcggcgctctgggtggcgctgccc
ggcctcgcccccggccggcagcgggtgcgcaccgcccggccctacggcgcggccggccgc
gagcgcccgctcgagctggaggtgggcttcgtcctgcccctgccggcctactggcgggtc
gagtggtcgcccgcgacgcggctgggtttccgcggtcggcaggtcgcgggcctcggctgg
gggcgcgtgcggctgcggctcgaggccaccctccagccgcggcgccgcggcgagtacgag
cttcccggcgcgcgcctcttcgtacgcgacttcctggggatctacgagcgcgaggtgcgc
ctcgagggtccgcgggagcgcctcttcgtctacccccgcatctgggagcagctgccgccg
cagctggcgctgacgctgctcgccgaggggcccgagtcgcccgagctcggcctcgaggac
gcggggcgctaccggggcacgcgcgagtaccggccgggcgacgcgctccggcggatgcac
tggaaggcgacggcccgccagggccgcccgatggtgcgcgagttcgcctgggtgcgcgcc
acgggcgtctggatctacatcgacgttcgcggcggcgaggtctacatcgaccacatggcc
gagctggccgccagcctggccgtgcggctgatggacctgggcctcgccgtgggcctggcc
tggccggggttcgaacgccctcccgcacgcggcctcgaggcgctgcgggggatgctcgcc
gccctggcccggctcgagccggcgagggcggggggcgcgccgccgctgccgccgccgggg
gtgaacctggtcgtgttcacccaggacgccccgcccgagctgatcgagggggccctggcg
gcgcgggcgcgggcggcgcgggtgcacctgctcgccttccccgaaggcttcttcctgcgc
ccgggcgagaagggccgccccatctggggccgcaccgacggcatggcccgcctccaggag
cggcgcggtctgctccacgccgcaggcgtccacgtgcacgtcttccgcggcgacgaggcc
gtgcgcttcacgcgggcgtga

DBGET integrated database retrieval system