KEGG   Oceanithermus profundus: Ocepr_0594Help
Entry
Ocepr_0594        CDS       T01369                                 

Definition
(GenBank) Dinitrogenase iron-molybdenum cofactor biosynthesis protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: ADR36052
UniProt: E4U749
Position
593199..593537
Genome map
AA seq 112 aa AA seqDB search
MRIAIAVLPNATDTFPGPYGHAPFFAIYDRKDGAWQRIELRDNPYKALEGGGKPRLMKQL
LADCDLWVGAQFGHGPGHGHHHGPGHEPPAHRREVPRGLSVREVLALLEQDA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgcgatcgccgttctgcccaacgccaccgacaccttccccggcccctacggc
catgcgcctttctttgcgatctacgaccgcaaggacggggcctggcagcgcatcgaactg
cgcgacaacccctacaaggccctcgaaggcgggggcaagccccgcctgatgaagcaactt
ctcgccgactgcgacctctgggtgggggcccagttcggccacggacccggccacgggcac
caccacgggcccggacacgagccgccggcgcaccggcgcgaggtgccccgggggttgagc
gtgcgcgaggtgctggcgctgctcgagcaggacgcctag

DBGET integrated database retrieval system