KEGG   Oceanithermus profundus: Ocepr_0596Help
Entry
Ocepr_0596        CDS       T01369                                 

Definition
(GenBank) protein of unknown function DUF1028
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1028 PG_binding_2 PG_binding_1 VapB_antitoxin
Motif
Other DBs
NCBI-ProteinID: ADR36054
UniProt: E4U751
Position
complement(594195..595064)
Genome map
AA seq 289 aa AA seqDB search
MQPVSTFSLVARDPETGDLGVAVASKFLAVGAVVPAARAGVGAVATQSYANTSYGPRGLA
VLELGGSPEDAHRIFAATDPGHAQRQYGIVSAGGAAFTFTGDACHPWAGGRAGENYAAQG
NLLTGPEVVEALEATFLERTDLPFPERLTAALLAADRAGGDQRGRQSAALLVVGEGKGYG
GFNDRWIDLRVDDHPDPVPELERLLGIHRLLFNPARNARPLSDEEIRWIQAAAARLELYA
GPIDGTWSEAVEAALKALLGRENLEERYTGGPRLEEEVFAALREAYGEA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggtcagcaccttctccctcgtcgcccgcgaccccgagaccggcgacctcggc
gtcgccgtcgccagcaagttcctggccgtgggcgcggtcgtgcctgcagcccgcgccggc
gtcggcgccgtggccacccagtcctacgccaacaccagctacgggccccggggccttgcg
gtcctcgaactcgggggatcgcccgaggacgcccaccgcatcttcgcggcaaccgatccc
ggccacgcccagcggcagtacgggatcgtctccgccggcggcgcggccttcaccttcacc
ggcgacgcctgccacccctgggcgggcgggcgcgcgggcgagaactacgccgcgcagggc
aacctgctcaccggccctgaggtggtggaggcgctggaggcgaccttcctcgagcgcacc
gacctccccttccccgagcggctcacggccgccctgctggccgccgaccgcgccggcggc
gaccagcgcgggcgccagtcggcggcgctgttggtggtgggcgagggcaagggctacggc
ggcttcaacgaccgctggatcgacctgcgggtcgacgaccaccccgacccggtgcccgag
ctggagcggctcctgggcatccaccggctgctcttcaaccccgcccgcaacgcccggccg
ctctcggacgaggagatccgctggatccaggccgccgcggcccgcctggagctctacgcc
ggacccattgacggaacgtggagcgaggcggtcgaagcggcgctcaaggccctgctgggg
cgcgagaacctggaggagcgctacacgggcggaccccggctcgaagaagaggtgttcgcg
gccctgcgcgaagcttatggcgaagcctga

DBGET integrated database retrieval system