KEGG   Oceanithermus profundus: Ocepr_0607Help
Entry
Ocepr_0607        CDS       T01369                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
opr  Oceanithermus profundus
Pathway
opr00500  Starch and sucrose metabolism
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ocepr_0607
Enzymes [BR:opr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     Ocepr_0607
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     Ocepr_0607
    3.2.1.135  neopullulanase
     Ocepr_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase AMPK1_CBM Glyco_hydro_42C GHL5
Motif
Other DBs
NCBI-ProteinID: ADR36065
UniProt: E4U762
Position
605637..607772
Genome map
AA seq 711 aa AA seqDB search
MRKLITFLLVLVLGLALAVKVTFKYTPPPGLAVDSVSLRGSFNNWGETPMQPQPDGSWAV
TLDLDPGEYTYKFFINGQWPKDMCDDPTFGRPMVDPTADGCTDDGFGGQNAVRIVEAPVV
KKASGPVELAFEHDPAQARYLSVADGRLAVRFSAGAGSVASAELIAGDARYEMYPQLEAR
GRAFWRVSLPDAPTSYRIHVVQTDGREATFGPFTYGGQAFRGLDWVGERVGYQIFPERFR
NGEPGNDELALASDEYIFNARWRRLDPENKPFLSPWNGPVTPQLCCHQYFGGDLTGVIQK
LDYLARQGVGLVYLNPVFDSGSAHGYDTHDYLKVSPKFGDKAVLRVLLDGAHARGIKVLF
DFVPNHTGLGFWAFRDVVRRGPNSPYWNWYFIKKWPFEPGDASAYEAWWNIGSLPKLNTG
NPAVRRYLLEVAKYWIRFGFDGVRVDVPGDLIDAHGFFAEMRRELKKVNPEAYLVAEIWQ
ADASWLEGDEFDSLMNYALGRGAILKYAKGKPAAFANGKRALREMSQVYAVLPEAATDMG
FNLIDSHDTSRLLTDLGGGKFGQQPSPEGLARQRLATAILYTLPGVPVHFQGDECAFVGE
KDPYDKQRYPLQWERCDAEMQAFYRGLATLKESLPAFDTAVWRAYLGEGPLLGFYRGEPG
PGEVLALFNNSTEPQTAPLPPGAWQDVQTRRTYRKQVPLEPLGWRYLRHRP
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaactcatcacgttcttgctggtgctggttctgggtctggccctggccgtcaag
gtgaccttcaagtacacgccgccgccggggctggcggtggactcggtcagcctgcgcggc
agcttcaacaactggggcgaaacgccgatgcagccccagcccgacggttcctgggcggtg
accctcgacctcgacccgggcgaatacacctacaagttcttcatcaacggccagtggccg
aaggacatgtgcgacgaccccaccttcggccgtcccatggtcgacccgaccgccgacggc
tgcaccgacgacggtttcggcggccagaacgcggtgcgcatcgtggaagctccggtcgtc
aagaaggccagcggaccggtggagctcgccttcgagcacgaccccgcccaggcgcgctac
ctctcggtggccgacggccggctggccgtgcgtttttcggccggggcgggcagcgtagcg
agcgcggagctgatcgccggggacgcgcgctacgagatgtacccgcagctcgaggcacgg
gggcgggcgttctggcgcgtcagcctgcccgacgcgcctacgagctaccgcatccacgtg
gtccaaacggacgggcgcgaggccaccttcggcccctttacctacggcgggcaggccttc
cgcggcctcgactgggtgggcgagcgggtgggctaccagatcttcccggagcgtttcagg
aacggcgagccgggcaacgatgagctggcgctggccagcgacgagtacatcttcaacgcc
cggtggcggcggctcgaccccgagaacaagcccttcctctcgccctggaacggaccggtc
acgccgcagctctgctgccaccagtacttcggcggcgaccttaccggcgtgatccaaaag
ctcgactacctggcccgtcagggggtggggctcgtctacctgaaccccgtcttcgactcg
ggatcggcccatggctacgacacccacgactacctcaaggtctcgcccaagttcggcgac
aaggccgtgctgcgggtcctcctcgacggggcccacgcccgcggcatcaaggtgctcttc
gacttcgtgcccaatcacaccgggctgggtttctgggccttccgcgacgtggtgaggcgc
ggccccaactcgccctactggaactggtacttcatcaagaagtggcccttcgagccgggc
gacgccagcgcctacgaggcctggtggaacatcggcagcctgcccaaactgaacaccggc
aaccccgcggtgcggcggtacctgctcgaggtggcgaagtactggatccgcttcggcttc
gacggcgttcgggtggacgttccgggcgacctcatcgacgcccacggcttcttcgccgag
atgcggcgcgagctcaagaaggtcaaccccgaggcctacctggtggccgagatctggcag
gccgacgccagctggctcgagggggacgagttcgacagcctgatgaactacgccctgggc
cgcggcgcgatcctcaagtacgccaagggcaagccggcggcgttcgccaacggcaagcgc
gcgctgcgggagatgagccaggtctacgcggtgctgccggaggcggcgaccgacatgggc
ttcaacctcatcgactcgcacgacaccagccgcctgctcaccgacctgggcggaggaaag
ttcggccagcagccctcgcccgaggggttggcgcggcagcgtctggcgacggcgatcctc
tacacgctgcccggcgtgccggtgcacttccagggcgacgagtgcgccttcgtgggcgag
aaggacccctacgacaagcagcgctaccccctgcagtgggagcgctgcgacgccgagatg
caggccttctaccgcgggctggcgacgttgaaggaaagcctgcccgccttcgataccgcc
gtctggcgcgcctacctgggcgaggggccgcttctcggtttctaccgcggcgagcccggc
cccggagaggtgctggcgcttttcaacaactccacggagccccagaccgcgccgctgccc
ccgggcgcctggcaggacgtgcagacccggcggacctaccgcaaacaggtgccgctcgag
ccgctggggtggcgctacctgcgccaccgcccctga

DBGET integrated database retrieval system