KEGG   Oceanithermus profundus: Ocepr_0609Help
Entry
Ocepr_0609        CDS       T01369                                 

Definition
(GenBank) dihydrouridine synthase DuS
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADR36067
UniProt: E4U764
Position
608932..609873
Genome map
AA seq 313 aa AA seqDB search
MREWPLSPNDDGAVLAPMASLTDAPFRLVSERFGALWAVGEMVMAGSLLQESVEGWRLLR
LHPEERSRVVQLAGADPGEVARAAARVRERVGPRAIDLNMGCPMPKVTARGAGAALMDDP
ARAARMVAGVREATGLPVSVKLRLGFSRANAVEVARALEQAGAALLRVHGRTAQQRYGGR
ADWDAVREVARAVRIPVVGTGDVRSVEDYRARRGLGVGAAVARGALGRPWFFAEVRRERV
DAAARRAAAREHLSLHLAWYADRGEVWALRAFRGHLKAYLSAAPAEVRARALALERAEEV
AEVLGAWVGVGGT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaatggccgctctccccaaacgatgacggggcggtgctcgcccccatggccagc
ctcaccgacgcgcccttccggctcgtcagcgagcgcttcggggcgctgtgggcggtgggg
gagatggtcatggcgggctcgctgctgcaggagtcggtggaggggtggcggctcttgcgg
ctccaccccgaggagcgttcgcgggtggtgcagctcgcgggcgcggacccgggcgaggtc
gcccgggccgcggcccgggtacgggagcgggtgggcccccgcgccatcgacctgaacatg
ggctgccccatgcccaaggtgacggcgcggggcgcgggggcggcgctgatggacgacccc
gcgcgggcggcacgcatggtggccggagtgcgcgaagcgaccggcctgccggtgagcgtg
aaactgcggctcgggttttcgcgggcgaacgcggtggaggtggcccgggcgcttgagcag
gccggggcggcgctgctgcgcgtgcacgggcgcacggcgcagcagcgctacgggggccgg
gccgactgggacgcggtgcgcgaggtggcgcgggcggtgcggattcccgtggtggggacg
ggcgacgtgcgcagcgtggaagactaccgcgcccgccgcggcctgggggtgggcgcggcc
gtggcgcggggcgcgctggggcggccgtggttcttcgccgaggtgcgccgcgagcgggtg
gacgccgccgcgcggcgcgcggcggcccgggagcacctgagcctccacctggcgtggtac
gcggaccgcggcgaggtctgggcgctgcgcgcctttcgcgggcacctaaaggcctacctg
agcgcggccccggccgaggtgcgcgcccgggcgctggcgctcgagcgggcggaggaggtg
gccgaggtgctgggggcgtgggtgggtgtaggtggtacgtag

DBGET integrated database retrieval system