KEGG   Oceanithermus profundus: Ocepr_0752Help
Entry
Ocepr_0752        CDS       T01369                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
opr  Oceanithermus profundus
Pathway
opr00340  Histidine metabolism
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01230  Biosynthesis of amino acids
Module
opr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ocepr_0752
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Ocepr_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PSP
Motif
Other DBs
NCBI-ProteinID: ADR36209
UniProt: E4U780
Position
758984..760294
Genome map
AA seq 436 aa AA seqDB search
MEIPRYEAKEVRGRFAARRLQFALSERVRAGIRSAFGEELSAEEAVRRIVGDVAAGGQKA
LDEWSLKLDRHATYEVPKREWREAYDDLSTELREALGIARERLEKFHRKEPKGGFLAATS
GGMLAQIVRPIRRVGAYVPGGSAPLLSTVLHTVVLARVAGVQEVIVATPPPVHPGVMAAA
WAAGADRLFAMGGAQAVAALAYGTEQVPRVDKIVGPGNLFVTLAKKEVYGVVGIDGLAGP
TETLIVADASADPATVAADLLAQAEHDPAAEPWLLSPDAGLLDAVAAELERQLETLPRAE
IARAALQNGGLVQVRDLSSALELADLYAPEHLCLSVERPTDWLGQVNNAGGVFLGEHSGE
AIGDYLAGPSHVMPTSGSARWTGALAVRDFLKIVPVVALSARAAAELSALGARLAREEEL
EAHARSLERRAGPSGA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggagatccccaggtacgaggccaaggaggtgcgcgggcgctttgcggcccgccggttg
cagttcgccctcagcgagcgggtgcgtgcgggcattcggagcgcctttggcgaggagctc
agcgccgaggaggccgtgcgccgcatcgtcggcgacgtggccgccggcgggcagaaggcg
ctcgacgaatggagcctgaagctcgaccgccacgccacctacgaggtgcccaaacgcgag
tggcgggaggcctacgacgacctgagcaccgagctgcgcgaggccctgggcatcgcccgc
gagcgcctggagaagtttcaccgcaaggaaccgaagggcggtttcctggccgccacctcg
gggggcatgctggcgcagatcgtgcgccccatccgccgcgtgggggcctatgtgcccgga
ggcagcgcgccgctgctctcgacggtgctccacaccgtggtgctcgcgcgcgtggccggg
gtgcaggaggtgatcgtggcgacgccgcccccggtgcacccgggggttatggccgccgcc
tgggccgcaggcgccgaccgcctcttcgccatgggcggggcccaggccgtcgccgcgctg
gcctacgggacggagcaggtgccgcgggtggacaagatcgtggggccgggcaacctcttc
gtcacgctcgccaagaaggaggtctacggggtggtcggcatcgacggcctggccgggccc
accgagaccctgatcgtcgccgacgccagcgccgaccccgccaccgtggccgccgacctg
ctggcccaggccgagcacgaccccgcggccgagccctggctgctctcgcccgacgccggg
ctgctcgacgcggtggcggcggagctcgagcgccagctcgaaaccctgccgcgcgcggag
atcgcgcgcgcggccttgcagaacggcgggctggtccaggtgcgcgacctgagcagcgcc
ctcgagctcgccgacctgtacgcccccgagcacctctgcctttcggtggaacgccccacc
gactggctgggacaggtcaacaacgccggcggcgtcttcctgggggagcattcgggcgag
gccatcggcgactacctggccgggcccagccacgtgatgcccacctcgggttcggcccgc
tggacgggcgctctggcggtgcgcgacttcctcaagatcgtgccggtggtggcgctcagc
gcccgggccgccgccgagctttcggcgttgggggcgcggttggcgcgcgaggaggagctg
gaggcgcacgcccgctcgctcgagcggcgcgcggggccctcaggcgcgtag

DBGET integrated database retrieval system