KEGG   Oceanithermus profundus: Ocepr_0783Help
Entry
Ocepr_0783        CDS       T01369                                 

Definition
ribulose-5-phosphate 3-epimerase
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
opr  Oceanithermus profundus
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_0783
   01230 Biosynthesis of amino acids
    Ocepr_0783
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ocepr_0783
   00040 Pentose and glucuronate interconversions
    Ocepr_0783
Enzymes [BR:opr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Ocepr_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
788628..789287
Genome map
AA seq 219 aa AA seqDB search
MPLIAPSILSADFARLADQVRAAEAAGADWIHVDVMDGRFVPNITMGFVVVEALRPVTRL
PLDVHLMIVEPERYVERFVAAGADVVTVHVEATAHVHRTLQLIRSAGARAGLAVNPATPL
DWFEDVLGELDLALLMSVNPGFGGQRFIPRSLERLERLAALRDRVNPEARIEVDGGVGPG
NAAELVRRGADVLVAGSAVFGGDGTVAENLSALRDAAQA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccccttatcgcaccttccatcctatccgccgacttcgcccgtctggccgaccaggtt
cgcgcggccgaggcggccggcgccgactggatccacgtcgacgtgatggacgggcgcttc
gtgcccaacatcacaatgggcttcgtcgtcgtcgaagcgttgcgcccggtcacccgcctg
cccctggacgtccacctgatgatcgtggagcccgagcgctacgtcgagcgcttcgtcgcc
gccggcgccgacgtggtgaccgtccacgtcgaggcgacggcgcacgtccaccggacgctg
cagctgattcgttccgcgggcgcccgggcggggctggccgtgaaccccgccacgcccctc
gactggttcgaggacgtgctgggcgagctcgacctggcgcttctgatgagcgtcaacccc
ggcttcggggggcagaggttcatcccccgcagcctcgagcggctcgagcggctggccgcg
ctgcgcgaccgcgtcaaccccgaagcgcgcatcgaggtggacggcggggtcggccccggc
aacgccgccgagttggtgcggcggggggccgacgtgctggtcgcgggttcggccgtcttc
ggcggcgacggcacggtcgccgaaaacctgagcgcgctccgcgatgccgcgcaggcttag

DBGET integrated database retrieval system