KEGG   Oceanithermus profundus: Ocepr_0783Help
Entry
Ocepr_0783        CDS       T01369                                 

Definition
(GenBank) ribulose-5-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
opr  Oceanithermus profundus
Pathway
opr00030  Pentose phosphate pathway
opr00040  Pentose and glucuronate interconversions
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01120  Microbial metabolism in diverse environments
opr01130  Biosynthesis of antibiotics
opr01200  Carbon metabolism
opr01230  Biosynthesis of amino acids
Module
opr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ocepr_0783
   00040 Pentose and glucuronate interconversions
    Ocepr_0783
Enzymes [BR:opr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Ocepr_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C DAGK_cat NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADR36240
UniProt: E4U7B1
Position
788628..789287
Genome map
AA seq 219 aa AA seqDB search
MPLIAPSILSADFARLADQVRAAEAAGADWIHVDVMDGRFVPNITMGFVVVEALRPVTRL
PLDVHLMIVEPERYVERFVAAGADVVTVHVEATAHVHRTLQLIRSAGARAGLAVNPATPL
DWFEDVLGELDLALLMSVNPGFGGQRFIPRSLERLERLAALRDRVNPEARIEVDGGVGPG
NAAELVRRGADVLVAGSAVFGGDGTVAENLSALRDAAQA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccccttatcgcaccttccatcctatccgccgacttcgcccgtctggccgaccaggtt
cgcgcggccgaggcggccggcgccgactggatccacgtcgacgtgatggacgggcgcttc
gtgcccaacatcacaatgggcttcgtcgtcgtcgaagcgttgcgcccggtcacccgcctg
cccctggacgtccacctgatgatcgtggagcccgagcgctacgtcgagcgcttcgtcgcc
gccggcgccgacgtggtgaccgtccacgtcgaggcgacggcgcacgtccaccggacgctg
cagctgattcgttccgcgggcgcccgggcggggctggccgtgaaccccgccacgcccctc
gactggttcgaggacgtgctgggcgagctcgacctggcgcttctgatgagcgtcaacccc
ggcttcggggggcagaggttcatcccccgcagcctcgagcggctcgagcggctggccgcg
ctgcgcgaccgcgtcaaccccgaagcgcgcatcgaggtggacggcggggtcggccccggc
aacgccgccgagttggtgcggcggggggccgacgtgctggtcgcgggttcggccgtcttc
ggcggcgacggcacggtcgccgaaaacctgagcgcgctccgcgatgccgcgcaggcttag

DBGET integrated database retrieval system