KEGG   Oceanithermus profundus: Ocepr_1026Help
Entry
Ocepr_1026        CDS       T01369                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
opr  Oceanithermus profundus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_1026
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ocepr_1026
   00640 Propanoate metabolism
    Ocepr_1026
   00660 C5-Branched dibasic acid metabolism
    Ocepr_1026
Enzymes [BR:opr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ocepr_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1053100..1054233
Genome map
AA seq 377 aa AA seqDB search
MKLHEFQAKELLAQYGVPVPPGKVAYGPEEAERIAKDFGKQVVIKAQVHVGGRGKAGGVK
LAQPEEAREVAGKILGMDIKGLTVKKVLVAEAVDIAREYYAGLIIDRSSQRAVLMVSKEG
GVDIEEVARTNPEAIVKYPIDPHKGLRHFEAREVVKQAGLEGNLNRLANVIVQLYNAFKG
VDASLAEINPLVVTEQGEIIAADAKIDLDDNALFRHPDLAKLREVEAEHPLEIEASNYGF
AYVKLDGDVGVIGNGAGLVMYTLDLVNRAGGKPANFLDIGGGAKAEVVYNAVKLVAKDPD
VKGIFINIFGGITRADEVAKGVIQALEEGLVKVPVVMRVAGTAEEEAKKLLEGKPIYLYP
NSLEAAGAIVTMVGGAK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactccacgaattccaagcaaaagagttgttggcccagtacggcgtacccgtgcct
ccgggcaaggtggcctacggccccgaagaggccgagcgcatcgccaaggacttcggcaag
caggtggtcatcaaggcccaggtccacgtgggcggtcgcggcaaggccggcggcgtcaag
ctagcccagcccgaggaggcgcgcgaggtcgccggaaagatcctggggatggacatcaag
ggcctgacggtgaagaaggtcctggtggccgaggccgtggacatcgctcgtgagtactac
gcgggcctgatcatcgaccgctcgagccagcgcgccgtcctcatggtgagcaaggagggg
ggcgtggacatcgaggaggtggcccgcaccaaccccgaggccatcgtcaagtaccccatc
gacccgcacaagggcctgcgccacttcgaggcccgcgaggtcgtcaagcaggcggggctc
gagggcaacctcaaccggctcgcgaacgtgatcgtgcagctctacaacgccttcaagggc
gtggacgcctcgctcgccgagatcaaccccctggtcgtcaccgagcagggcgagatcatc
gccgccgacgccaagatcgacctggacgacaacgccctcttccgccaccccgacctggcc
aagctgcgcgaggtcgaggccgagcacccgctcgagatcgaggccagcaactacggcttc
gcctacgtcaagctcgacggcgacgtgggcgtgatcggcaacggtgcggggctggtgatg
tacaccctcgacctggtgaaccgcgccggcggcaaacccgccaacttcctcgacatcggc
ggcggcgccaaggccgaggtcgtctacaacgcggtcaagctggtggccaaggacccggac
gtgaagggcatcttcatcaacatcttcgggggcatcacccgcgccgacgaggtggccaag
ggcgtgatccaggccctggaggaaggcctcgtcaaggttccggtggtcatgcgcgtggcc
gggaccgccgaggaagaggccaagaagctcctcgaaggcaagccgatctacctctacccc
aactcgctcgaggcggcgggggcgatcgtgaccatggtgggaggcgcgaagtga

DBGET integrated database retrieval system