KEGG   Oceanithermus profundus: Ocepr_1103Help
Entry
Ocepr_1103        CDS       T01369                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
opr  Oceanithermus profundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ocepr_1103
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ocepr_1103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ocepr_1103
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ocepr_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1129874..1131094
Genome map
AA seq 406 aa AA seqDB search
MYLPEYPLPDERGRFGPYGGRYVPETLMPALEELEAAYRRLRRDPDFLAELDDHLRHYAG
RPSPLYFARNLTETWGGARVYLKREDLNHTGAHKINNTLGQALIAKRMGKRRVIAETGAG
QHGVSVATVAALFGLEAVIYMGAEDVRRQELNVFRMELLGAEVRTVTSGTQTLKDATNEA
IRDWVTNVETTFYILGSVVGPHPYPMLVRDLQSVIGLELARQLQEAEGRNTPDAIVAAVG
GGSNAIGAFAPFAYLPPEKRPRLIGVEAAGEGLASGRHAASIGAGKRGVLHGSYMYLLHD
EDGQILPAHSVSAGLDYPGVGPEHSHYADAGVAEYVAVTDEEALAAFQLLSRAEGILPAL
ESAHAVAYAARLAPQMGRDEVLVINLSGRGDKDVTEVMRLLGKESR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttcccgagtaccctttaccggacgaacgcggacggttcggcccctacggcggc
cgctacgtccccgagacgcttatgccggccctggaagagctggaggccgcctaccgacgg
ctgcgccgcgaccccgacttcctcgccgagctggacgaccatctgcgccactacgccggc
cgccccagccccctctacttcgcccgtaacctgaccgaaacctggggcggggcgcgggtc
tacctcaagcgcgaggaccttaaccacacgggggcgcacaagatcaacaacaccctgggc
caggccctgatcgccaaacggatgggcaagcgccgcgtcatcgccgagaccggcgcgggc
cagcacggcgtcagcgtggccacggtggcggcgctgttcggcctggaggcggtgatctac
atgggcgcggaggacgtccggcggcaggagctcaacgtcttccggatggagctgctgggg
gccgaggtgcgcaccgtgaccagcggcacccaaacgctcaaggacgcaacgaacgaggcc
atccgcgactgggtcaccaacgtggagacgaccttctacatcctcggctccgtggtgggg
ccccatccctacccgatgctggtgcgcgacctgcagagcgtcatcgggttggagctcgcc
cgccagctccaggaagccgaaggcaggaacaccccggacgccatcgtcgccgccgtgggc
gggggctcgaacgccatcggcgccttcgcgcccttcgcctacctgcccccggaaaaacgt
ccgcgcttgatcggcgtggaggcggcgggcgaggggctcgccagcggacgccacgcggcc
agcatcggcgccggtaagcgcggcgtgctgcacgggtcctacatgtatctgctccacgac
gaggacggccagattcttccggcccactcggtctccgcgggcctcgactacccgggggtg
ggccccgagcacagccactacgcggacgccggggtggccgagtacgtggccgtgaccgac
gaggaggccctcgcggccttccagctgctcagccgcgccgagggcatcctccccgcgctc
gagtcggcccacgcggtggcctacgccgcccgtctggcgccgcagatggggcgcgacgag
gtgctcgtcatcaacctttcgggcaggggcgacaaggacgttaccgaagtgatgcgtttg
ttgggaaaggagtcacgatga

DBGET integrated database retrieval system