KEGG   Oceanithermus profundus: Ocepr_1104Help
Entry
Ocepr_1104        CDS       T01369                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
opr  Oceanithermus profundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ocepr_1104
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ocepr_1104
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ocepr_1104
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ocepr_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1131091..1131864
Genome map
AA seq 257 aa AA seqDB search
MSRIQAAFRRARNEGRAAVVPYLTAGYPSPEAYLDTATQLLEFADLMEIGLPYSDPLGDG
PTIQRSGEAALRAGVRTADVVALVAALRQRTDKPLLLMTYVNPVFAWGPARFFAAFAEAG
LDGVILPDLPPDEDPEVVRAAHDAGLATVFLLAPTSTDARIREVVRHTTGFVYTVSVTGV
TGARSEMPDLAPLVGRIRSQTELPVAIGFGVSGAETARQAARVADGVVVGSALIKKLASG
EDPAPLLAEIRRAARVE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccaagccgctttccggcgcgcccggaacgaagggcgggccgccgtcgtc
ccctacctgaccgcgggttacccgagccccgaagcctacctggacacggcgacccaactg
ctcgagttcgccgacctgatggagatcggcctgccgtattcggatcccctgggggacggc
ccgacgatccagcgatcgggcgaggcggcgctgcgcgccggggtgcgcaccgccgacgtc
gtcgcgctggtggccgcgctgcggcagcgtaccgacaagccgctcttgctgatgacctac
gtcaaccccgtcttcgcctggggcccggcgcgcttcttcgcagccttcgcggaggccggg
ctcgacggggtcatcctcccggacctgcccccggacgaggatccggaggtcgtgcgcgcc
gcgcacgacgctggactcgccaccgtcttcctgctcgccccgacctccaccgacgcgcgc
atccgggaggtggtccggcacacgaccggcttcgtctacaccgtcagcgtgaccggggtg
accggcgcccgcagcgagatgcccgacctcgcgcccctggtgggccgcatccgttcgcag
accgagctgcccgtcgcgatcggcttcggcgtctccggcgccgagacggcccgccaggcg
gcgcgcgtcgccgacggcgtcgtcgtcggttcggcgctcatcaagaaactggcctccggc
gaggatcccgcgcccctgctcgccgagatccggcgggcggcgcgcgtagaatag

DBGET integrated database retrieval system