KEGG   Oceanithermus profundus: Ocepr_1104Help
Entry
Ocepr_1104        CDS       T01369                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
opr  Oceanithermus profundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ocepr_1104
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ocepr_1104
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ocepr_1104
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ocepr_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1131091..1131864
Genome map
AA seq 257 aa AA seqDB search
MSRIQAAFRRARNEGRAAVVPYLTAGYPSPEAYLDTATQLLEFADLMEIGLPYSDPLGDG
PTIQRSGEAALRAGVRTADVVALVAALRQRTDKPLLLMTYVNPVFAWGPARFFAAFAEAG
LDGVILPDLPPDEDPEVVRAAHDAGLATVFLLAPTSTDARIREVVRHTTGFVYTVSVTGV
TGARSEMPDLAPLVGRIRSQTELPVAIGFGVSGAETARQAARVADGVVVGSALIKKLASG
EDPAPLLAEIRRAARVE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccaagccgctttccggcgcgcccggaacgaagggcgggccgccgtcgtc
ccctacctgaccgcgggttacccgagccccgaagcctacctggacacggcgacccaactg
ctcgagttcgccgacctgatggagatcggcctgccgtattcggatcccctgggggacggc
ccgacgatccagcgatcgggcgaggcggcgctgcgcgccggggtgcgcaccgccgacgtc
gtcgcgctggtggccgcgctgcggcagcgtaccgacaagccgctcttgctgatgacctac
gtcaaccccgtcttcgcctggggcccggcgcgcttcttcgcagccttcgcggaggccggg
ctcgacggggtcatcctcccggacctgcccccggacgaggatccggaggtcgtgcgcgcc
gcgcacgacgctggactcgccaccgtcttcctgctcgccccgacctccaccgacgcgcgc
atccgggaggtggtccggcacacgaccggcttcgtctacaccgtcagcgtgaccggggtg
accggcgcccgcagcgagatgcccgacctcgcgcccctggtgggccgcatccgttcgcag
accgagctgcccgtcgcgatcggcttcggcgtctccggcgccgagacggcccgccaggcg
gcgcgcgtcgccgacggcgtcgtcgtcggttcggcgctcatcaagaaactggcctccggc
gaggatcccgcgcccctgctcgccgagatccggcgggcggcgcgcgtagaatag

DBGET integrated database retrieval system