KEGG   Oceanithermus profundus: Ocepr_1141Help
Entry
Ocepr_1141        CDS       T01369                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
opr  Oceanithermus profundus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_1141
   01230 Biosynthesis of amino acids
    Ocepr_1141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ocepr_1141
   00051 Fructose and mannose metabolism
    Ocepr_1141
   00562 Inositol phosphate metabolism
    Ocepr_1141
Enzymes [BR:opr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ocepr_1141
Exosome [BR:opr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ocepr_1141
  Exosomal proteins of bladder cancer cells
   Ocepr_1141
  Exosomal proteins of melanoma cells
   Ocepr_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1165890..1166660
Genome map
AA seq 256 aa AA seqDB search
MRTPLLAGNWKMHKTPSEARVWFAEFLEANPTLQSGGQAAVEVALLPSFPLVPVAAEQLA
GSGVAWGAQDVSAHTFGAYTGEVAAEQLADLGCRYVVVGHSERRAYWNESDALVAAKARR
AMEAGLVPILCVGERLEEREAGRAVSFTLEQLAGSLEGVGLETGEELVIAYEPVWAIGTG
KTASADDAQAMAAAIRGFLAERYGESVAGRTRILYGGSMKPANTTEILAGPDVDGGLVGG
ASLEVASFSAMVEAAG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccccgctgctcgccggcaactggaagatgcacaagacccccagcgaagcccgg
gtctggttcgccgagttcctggaagccaacccgacgctgcaaagcggcggacaggcggcc
gtcgaggtggccctgctcccctcgttccccctcgtgcccgtcgccgccgagcagctcgcg
ggcagcggcgtggcctggggcgcgcaggacgtctcggcccacaccttcggcgcctacacc
ggcgaggtggccgccgagcagctggccgacctcggctgccgttacgtcgtcgtcggccac
agcgagcgccgcgcctactggaacgagtcggacgcgctcgtggccgccaaggcgcgccgc
gccatggaggcgggcctggtgcccatcctctgcgtcggcgaacggctggaggagcgcgag
gcgggccgggcggtgagcttcacgctcgagcagctggcgggcagcctcgagggggtgggg
ctcgaaaccggcgaggaactcgtgatcgcctacgagcccgtctgggcgatcggcaccggc
aagaccgcgtcggcggacgacgcccaggcgatggccgccgccatccgcggcttcctcgcc
gagcgctacggcgagtccgtggccggacgcacccggatcctctacggcggctcgatgaaa
cccgcgaacaccaccgagattttggcgggccccgacgtggacggcgggctcgtcggcggc
gccagcctggaggtggcctccttcagcgccatggtcgaggccgcgggctag

DBGET integrated database retrieval system