KEGG   Oceanithermus profundus: Ocepr_1141Help
Entry
Ocepr_1141        CDS       T01369                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
opr  Oceanithermus profundus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:opr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:opr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:opr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:opr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:opr00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1165890..1166660
Genome map
AA seq 256 aa AA seqDB search
MRTPLLAGNWKMHKTPSEARVWFAEFLEANPTLQSGGQAAVEVALLPSFPLVPVAAEQLA
GSGVAWGAQDVSAHTFGAYTGEVAAEQLADLGCRYVVVGHSERRAYWNESDALVAAKARR
AMEAGLVPILCVGERLEEREAGRAVSFTLEQLAGSLEGVGLETGEELVIAYEPVWAIGTG
KTASADDAQAMAAAIRGFLAERYGESVAGRTRILYGGSMKPANTTEILAGPDVDGGLVGG
ASLEVASFSAMVEAAG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccccgctgctcgccggcaactggaagatgcacaagacccccagcgaagcccgg
gtctggttcgccgagttcctggaagccaacccgacgctgcaaagcggcggacaggcggcc
gtcgaggtggccctgctcccctcgttccccctcgtgcccgtcgccgccgagcagctcgcg
ggcagcggcgtggcctggggcgcgcaggacgtctcggcccacaccttcggcgcctacacc
ggcgaggtggccgccgagcagctggccgacctcggctgccgttacgtcgtcgtcggccac
agcgagcgccgcgcctactggaacgagtcggacgcgctcgtggccgccaaggcgcgccgc
gccatggaggcgggcctggtgcccatcctctgcgtcggcgaacggctggaggagcgcgag
gcgggccgggcggtgagcttcacgctcgagcagctggcgggcagcctcgagggggtgggg
ctcgaaaccggcgaggaactcgtgatcgcctacgagcccgtctgggcgatcggcaccggc
aagaccgcgtcggcggacgacgcccaggcgatggccgccgccatccgcggcttcctcgcc
gagcgctacggcgagtccgtggccggacgcacccggatcctctacggcggctcgatgaaa
cccgcgaacaccaccgagattttggcgggccccgacgtggacggcgggctcgtcggcggc
gccagcctggaggtggcctccttcagcgccatggtcgaggccgcgggctag

DBGET integrated database retrieval system