KEGG   Oceanithermus profundus: Ocepr_1217Help
Entry
Ocepr_1217        CDS       T01369                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
opr  Oceanithermus profundus
Pathway
opr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01130  Biosynthesis of antibiotics
opr01230  Biosynthesis of amino acids
Module
opr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ocepr_1217
Enzymes [BR:opr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ocepr_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PDZ
Motif
Other DBs
NCBI-ProteinID: ADR36674
UniProt: E4U8J4
Position
complement(1245775..1246557)
Genome map
AA seq 260 aa AA seqDB search
MVPDLNRVPGVLGRIARRRLERVAAGGRRTHGPPAGRPPSFAEALAAPGLSVIAEVKRKS
PSEGAIADLDAAEVARAYARAGARAVSVLTEPEFFAGSDADLEAARAAVELPLLRKDFVV
HPVQVDEARALGASAVLLIVAVLGPLTGAYLEAARTAGLDALVEVHDEREAELALEAGAE
ILGVNNRDLTTLRVDLGTAPRVARHVRALGFDGLLVAESGYRAREELAALEGRFDAVLIG
SSLARDPDPEAALRRLIGSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgaccttaaccgcgttcccggcgtgctggggcgcatcgcccgccgccgcttg
gagcgggtcgcagccggcggccggcggacgcacggcccgccggccgggcggccgccctcc
ttcgcggaggcgctggcggcgccgggcctctcggtgatcgccgaggtcaagcgcaagagc
ccttcggagggggcgatcgccgacctggacgccgccgaggtggcgcgcgcctacgcccgc
gcgggggcgcgggccgtgagcgtgttgaccgaacccgagttcttcgccgggagcgacgcc
gacctggaggccgcgcgcgcggccgtggagctgccgcttctgcgcaaggacttcgtggtt
catccggtccaggtggacgaggcgcgcgcgctcggggcctcggcggtgctgctcatcgtg
gccgtactgggcccgctcaccggggcctacctggaggcggcgcgcactgcggggctcgac
gccctggtcgaggtgcacgacgaacgcgaggcggagctggccctggaagccggggcggag
atcctgggcgtgaacaaccgcgacctgacgacgctgcgggtggacctgggcacggccccc
cgggtggcccgccacgtccgcgcgttgggtttcgatgggttgctggtggccgagtccggc
taccgcgcccgcgaagagctcgcggccctcgaagggcgtttcgacgccgtgctcatcggc
agctcgctggcgcgcgatccggaccccgaagcggcgctgcggcgcctcatcggctcagct
taa

DBGET integrated database retrieval system