KEGG   Oceanithermus profundus: Ocepr_1302Help
Entry
Ocepr_1302        CDS       T01369                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
opr  Oceanithermus profundus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ocepr_1302
Enzymes [BR:opr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ocepr_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1338243..1339754)
Genome map
AA seq 503 aa AA seqDB search
MELPRSFGILLHPTSFPGPYPIGNLGDEARSFLDWLAATGARWWQVLPLGPTGFGDSPYQ
AFSAFAGNPYLIDPRRLVARGWLEAADPPESPPDRVDYGLVYRWIWPLLRRAYAGFRARA
TREDTHALAVFEREHADWLEDYALFMALKGEHGGAPWWSWPEPLKRRDPGALAAARERLA
EEAAFQRWTQWVFFSQWRALANAAHDLGLGIVGDMPIFVAHDSADVWAHPELFQLDEDLN
PVAVAGVPPDYFSPTGQLWGNPLYDWDALERSGFDWWLRRIRRALETADLVRIDHFRGFE
AYWAVPAGAPTAEHGRWEKAPGEAFFRKVEATFGSVPILAEDLGLITPEVEALRDRFGLP
GMKVLQFAFTGEDNPFLPHNYPESGNCVVYTGTHDNDTTRGWCEHAPDAELDFMRRYLEG
RGIACRGCQDAPWALIELALQSRCRMAVFPLQDPLELGSEARMNFPSRPEGNWAWRYSTR
DLTHGLAERLRGLAERYARLRRG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagctcccgcgcagcttcggcatcctgctgcaccccacatcgttccccggaccctac
cccatcggcaacctcggcgacgaggcccgctccttcctggactggctcgcggctaccggc
gcccgctggtggcaggtgctgcccctggggccgaccggattcggcgactcgccctaccag
gcgttctcggccttcgccggcaacccctacctgatcgacccgcggcggctcgtcgcgcgg
ggttggctcgaggccgccgaccccccggagtcgccgcccgaccgggtggactacggcctc
gtctaccgctggatctggcctttgctgcgccgcgcttacgccgggttccgggcccgtgca
acgcgcgaggacacgcacgcgctcgcggtcttcgagcgtgagcacgccgactggctcgag
gactacgcgctcttcatggcgctcaagggcgagcatggcggcgccccctggtggtcctgg
cccgagcccctgaagcgccgggaccccggcgcactggccgcggcgcgcgagcgcctggcc
gaggaggccgccttccaacgctggacccagtgggtcttcttttcgcagtggcgtgcgctc
gcgaatgccgcccacgacctgggcctcggcatcgtcggcgacatgcccatcttcgtggcg
cacgactcggccgacgtttgggcccatcccgaactcttccaactcgacgaggatctcaac
cccgttgccgtggccggggtgccgcccgactacttcagccccaccggccagctctggggc
aacccgctctacgactgggacgccctcgagcgcagcggcttcgactggtggctgcggcgc
attcgccgggcgctcgagaccgccgacctcgttcgcatcgaccacttccggggcttcgag
gcctactgggccgtaccggcgggcgcccccacggcggaacacggccgctgggagaaggcc
cccggcgaggcgttctttcgcaaggtcgaggcgacctttggttcggttcccatcctcgcc
gaagacctggggctgatcacccccgaggtggaggccctgcgcgaccgcttcggactgccg
ggcatgaaggtcttgcagttcgccttcaccggcgaggacaaccccttcctgccccacaac
tacccggagtcgggcaactgcgtggtctacaccgggacccacgacaacgacaccacccgc
ggctggtgcgagcacgccccggatgcggagctcgacttcatgcgccgttacctggaggga
cggggcatcgcctgccgcggttgccaggacgctccctgggccctgatcgagctggcgctg
caaagccgctgccgcatggccgtctttccgctgcaggatccgctggaactgggatcggag
gcgcggatgaacttcccctcacggcccgaggggaactgggcctggcgctactccacccgg
gacctgacgcacgggctggccgagcggctgagggggttggcggaacgctacgcccgcctc
agacgcggatga

DBGET integrated database retrieval system