KEGG   Oceanithermus profundus: Ocepr_1318Help
Entry
Ocepr_1318        CDS       T01369                                 

Definition
(RefSeq) l-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
opr  Oceanithermus profundus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ocepr_1318
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ocepr_1318
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ocepr_1318
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ocepr_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354103..1355155
Genome map
AA seq 350 aa AA seqDB search
MRRPLLERYRDRLPVGPDTPIVSLLEGDTPLVPLKGPPEARERGVRLFAKYEGANPTGSF
KDRGMTMAVSKAAEHGAAAVAAASTGNTAASAAAYAARAGMKAIVVLPAGYVAAGKVAQS
LVHGARIVQVSGNFDDALRLVRELTERYPVTLVNSVNPFRIQGQKTLAFEVADELGRAPD
YHALPVGNAGNITAHWMGYSELYEDGTLETRPRMLGFQAAGAAPIVRGEPVAEPKTVATA
IRIGRPASWEGATRARDESGGAIEAVTDEEILRAYHYLAHGEGLFVEPASAAGLAGVWRW
LREGRIEDGATVVLTLTGHGLKDPGTAEREVRLPDPVPPTLDAVARAAGL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgccccctgctcgaacgctaccgcgaccgcctccccgtcggtcccgacaccccg
atcgtgagcctgctcgagggcgacaccccgctggttccgctcaagggaccccccgaggcc
cgcgaacgcggcgtgcgcctcttcgccaagtacgagggcgcgaaccccacgggcagcttc
aaggaccgcggcatgacgatggccgttagcaaggccgccgagcacggcgccgcggccgtc
gccgcggccagcaccggcaacaccgccgcctcggccgccgcttacgccgcgcgcgcggga
atgaaggcgatcgtcgtcctccccgccggctacgtggccgccggcaaggtggcccaaagc
ctggtgcacggcgcgcgcatcgtccaggtgagcggcaacttcgacgacgccctgcgcctg
gtgcgcgagctgaccgaacgctatccggtcaccctggtcaactcggtcaaccccttccgc
atccaggggcagaagacgctcgccttcgaggtggccgacgagctcggccgcgcccccgac
taccacgcgctccccgtcggcaacgccggcaacatcaccgcccactggatgggctactcc
gagctctatgaggacggcaccctggaaacccgcccccgcatgctcggcttccaggcggcc
ggcgccgccccgatcgtgcgcggcgaaccggtggccgaacccaagaccgtggccacggcc
atccgcatcggccgccccgccagctgggagggcgccacccgcgcccgggacgagtcgggc
ggggccatcgaggcggtgaccgacgaggagatcctgcgcgcctaccactacctggcgcac
ggcgaggggctgttcgtggaaccagcttcggccgccggcttggccggggtctggcgctgg
ctgcgtgaagggcggatcgaagatggcgccaccgtggtcctcaccctgaccggccatggg
ctcaaggatccgggcaccgccgagcgcgaggtgcgcctgcccgaccccgtcccccccacc
ctggacgcggtggcccgggccgcgggactctag

DBGET integrated database retrieval system