KEGG   Oceanithermus profundus: Ocepr_1375Help
Entry
Ocepr_1375        CDS       T01369                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
opr  Oceanithermus profundus
Pathway
opr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:opr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ocepr_1375
DNA repair and recombination proteins [BR:opr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Ocepr_1375
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ocepr_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 zf-C3HC4_3 zf-RING_9 Prok-RING_4
Motif
Other DBs
NCBI-ProteinID: ADR36831
UniProt: E4U901
Position
complement(1408070..1408663)
Genome map
AA seq 197 aa AA seqDB search
MRYPDRLLALIRALARLPGVGPKSAQKLGLHLAQNKAEAAELAQALEEVRRHVGVCERCG
NLAEGPLCPVCADPARDAGVIAVVETAADVLAIEKSGEYTGVYHVLGGALNPLEGVGPEQ
LRVESLLERARSAREVILATSMTVEGEATAAYLSERLAGGPAKLSRPAYGLPVGGTLEYV
DEVTLARALAHRQPVSE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtaccccgaccggctgctcgccctgatccgggcgctggcccggcttcccggcgtg
ggtcccaagagcgcccagaagctgggccttcatctggcgcagaacaaggccgaggcggcg
gagctggcccaggcgctggaggaggtgcggcgccacgtgggcgtgtgcgaacgctgcggc
aacctggccgaggggccgctctgcccggtctgcgccgaccccgcgcgcgacgcgggggtg
atcgccgtggtcgagaccgcggccgacgtgctggccatcgagaagagcggggagtacacc
ggggtctaccacgtcctcggcggcgcgctcaacccgctcgagggcgtggggcccgaacag
ctgcgcgtcgagagcctgctcgagcgggcgcgctcggcgcgcgaggtcatcctggccacc
tcgatgaccgtcgagggtgaggccaccgccgcttacctgagcgaacggctcgccggcggt
ccggcgaagctgagccggccggcgtacggccttccggtcggaggtactttagaatacgtg
gacgaggtaacgttggcccgggcgctggcgcaccgtcaacccgtgtccgagtag

DBGET integrated database retrieval system