KEGG   Oceanithermus profundus: Ocepr_1377Help
Entry
Ocepr_1377        CDS       T01369                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
opr  Oceanithermus profundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:opr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1409040..1410011
Genome map
AA seq 323 aa AA seqDB search
MERPRRLRLRPSMRRLVREISLEPRHLVWPLFVHRGADPEPIASMPGQLRHSLDSLMTAA
AEAVHLQLGGIMVFGVLPQEEKNATGSGAYAEDGLVQEAIRRIKAEHPDLLVMADTCLCE
YTDHGHCGIVHEGTVDNDATLELLAKTAVSQARAGADVIAPSAMMDGQVAAIRAALDDAG
FAGTPVLSYAVKYASAFYGPFRDAADSAPAFGDRSSYQMDPAGGYWDALREAEIDDREGA
DMLMVKPALPYLDVLPLLKQRFHKPLAAYHVSGEYAMVKAAALNGWIDERRVVLESLVAL
RRAGAQFVLTYFAPDAARWLLEG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcccccgcaggttgcgcctacgcccgagcatgcgccggctggtacgcgagatc
agcctcgagccccgtcacctcgtctggccgctcttcgtgcaccgcggcgccgatccggag
cccatcgcctcgatgccggggcagctgcggcactccctggacagcctgatgaccgccgcc
gccgaggcggtgcacctgcagctcggcggcatcatggtcttcggcgtgctcccgcaggag
gagaagaacgccaccggcagcggcgcctacgccgaggacggcctggtgcaggaggccatc
cgccgcatcaaggccgaacacccggacctgctcgtcatggcggacacctgcctttgcgag
tacaccgatcacggccactgcggcatcgtgcacgaaggaaccgtggacaacgacgccacg
ctcgagctcctggccaagacggccgtgagccaggcccgcgcgggggccgacgtgatcgcc
cccagcgccatgatggacggacaggtggccgcgatccgcgccgccctcgacgacgcaggg
ttcgcgggcacccccgtcctttcgtacgcggtcaagtacgcgtcggccttctacggcccc
ttccgcgacgccgccgacagcgcgcccgccttcggcgaccgcagcagctaccagatggac
cctgcgggcgggtactgggacgccctgcgcgaggccgagatcgacgaccgggagggggcc
gacatgctcatggtcaagccggccctcccctacctggacgtgctgccgctgctcaaacag
cgtttccacaaaccgctggcggcctaccacgtctccggcgagtacgccatggtcaaggcc
gccgccttgaacggctggatcgacgagcgccgggtggtgctcgagtcgctcgtcgccctg
cgccgcgccggggcccagttcgtgctcacctacttcgccccggacgccgcccgctggctg
ctcgagggctag

DBGET integrated database retrieval system