KEGG   Oceanithermus profundus: Ocepr_1509Help
Entry
Ocepr_1509        CDS       T01369                                 

Definition
succinate dehydrogenase subunit d
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
opr  Oceanithermus profundus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:opr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:opr00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:opr00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:opr00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1541988..1542389
Genome map
AA seq 133 aa AA seqDB search
MAIKTRNFNEARQQASTNIELIWWVFMRVSGVLLVFLVLGHIYMNNIMISNTSIDYDYVA
SRFSQPLIKVYDLVMLALAMLHGTNGLRYVIDDYVHHAGWRSFIKFVLYFLVALLIATGT
MVLFSFPFNKVGG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagacccgtaacttcaacgaagcccgccagcaggccagcaccaacatcgag
ctcatctggtgggtcttcatgcgcgtctccggggtgctgctggtcttcctggtgctgggc
cacatctacatgaacaacatcatgatcagcaacacctcgatcgactacgactacgtcgcg
tccagattctcgcagccgctgatcaaggtctacgacctggtcatgctcgcgctggcgatg
ctccacggcaccaacggcctgcgctacgtgatcgacgactacgtccaccacgccggctgg
cgcagctttatcaagttcgtgctctacttcctggtcgcgttgctgatcgctaccggcacc
atggtcctcttcagcttcccgttcaacaaggtaggaggttag

DBGET integrated database retrieval system