KEGG   Oceanithermus profundus: Ocepr_1509Help
Entry
Ocepr_1509        CDS       T01369                                 

Definition
succinate dehydrogenase subunit d
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
opr  Oceanithermus profundus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_1509
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ocepr_1509
   00650 Butanoate metabolism
    Ocepr_1509
  Energy metabolism
   00190 Oxidative phosphorylation
    Ocepr_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1541988..1542389
Genome map
AA seq 133 aa AA seqDB search
MAIKTRNFNEARQQASTNIELIWWVFMRVSGVLLVFLVLGHIYMNNIMISNTSIDYDYVA
SRFSQPLIKVYDLVMLALAMLHGTNGLRYVIDDYVHHAGWRSFIKFVLYFLVALLIATGT
MVLFSFPFNKVGG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagacccgtaacttcaacgaagcccgccagcaggccagcaccaacatcgag
ctcatctggtgggtcttcatgcgcgtctccggggtgctgctggtcttcctggtgctgggc
cacatctacatgaacaacatcatgatcagcaacacctcgatcgactacgactacgtcgcg
tccagattctcgcagccgctgatcaaggtctacgacctggtcatgctcgcgctggcgatg
ctccacggcaccaacggcctgcgctacgtgatcgacgactacgtccaccacgccggctgg
cgcagctttatcaagttcgtgctctacttcctggtcgcgttgctgatcgctaccggcacc
atggtcctcttcagcttcccgttcaacaaggtaggaggttag

DBGET integrated database retrieval system