KEGG   Oceanithermus profundus: Ocepr_1589Help
Entry
Ocepr_1589        CDS       T01369                                 

Definition
uroporphyrinogen III synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
opr  Oceanithermus profundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:opr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1623765..1624475)
Genome map
AA seq 236 aa AA seqDB search
MEGVVLTRNPEKDRELARRLDAFGVPYASVPLLEHAPGPDFPDLAGALGEAWAWVAVTSP
TAAGFLARAWEAAGRPALRVAALGGGTARALERAGLTPEFTAPEAYGRALAETLPEPGPL
LWPTSSRAGEELGRVLEARGFRVRRLDAYTTRPRPLAPEEVARLEAAAVAAVASPSAVAA
WVRAAAARPPLAAIGRVTAEAARAAGFVCVVWPERPGVAGWAERIRDLYEEKGHLP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggggtcgtcctcacccgcaaccccgagaaggaccgcgagctcgcccgtcgcctc
gacgccttcggggtgccgtacgcgagcgtccccttgctggagcacgcgcccggacccgac
ttccccgacctcgccggtgcgttgggcgaggcctgggcctgggtggccgtgacctcgccc
accgcggccggtttcctggcgcgcgcctgggaggcggcggggcggccggcgctgcgggtg
gcggcgctgggcggaggcacggcccgggcgctcgagcgcgcggggctcacgcccgagttc
accgcccccgaggcctacggccgggcgctggccgagaccctgccggagcccggcccgctg
ctctggcccacctcgagccgggccggggaggagctgggccgcgtcttggaggcccggggc
ttccgggtgcggcggctcgacgcctacaccacccgcccccggccgctcgcgccggaagag
gtcgcgcggctcgaggccgccgccgtcgcggcggtcgcctcgccctcggcggtggcggct
tgggtgcgcgccgccgcggcccgccctccgctggccgcgattgggcgcgtgaccgcggag
gcggcgcgcgccgccggcttcgtctgcgtggtctggccggagcggcccggggtcgcgggc
tgggccgaacgaatccgcgacttgtacgaggaaaagggacacctgccctga

DBGET integrated database retrieval system