KEGG   Oceanithermus profundus: Ocepr_1695Help
Entry
Ocepr_1695        CDS       T01369                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
opr  Oceanithermus profundus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_1695
   01230 Biosynthesis of amino acids
    Ocepr_1695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ocepr_1695
   00030 Pentose phosphate pathway
    Ocepr_1695
   00051 Fructose and mannose metabolism
    Ocepr_1695
   00052 Galactose metabolism
    Ocepr_1695
  Energy metabolism
   00680 Methane metabolism
    Ocepr_1695
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ocepr_1695
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ocepr_1695
Protein phosphatases and associated proteins [BR:opr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ocepr_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1710250..1711218)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVMTSGGDAPGMNAALRAVVRWAAANEVEVVGIRRGYAGMIEGEFVPLAPRDVANI
IQRGGTILRTARSKAFLEPEGRAEAARRLAEAKIDGLVAIGGDGTFRGAIKMTQEHRIPI
VGVPGTIDNDLYGTDFTIGFDTAVNTALDAIDRIRDTAASHERVFFIEVMGRHAGFIALD
VGLAGGAEVIALPEIPTGPEEIAEQIRLSEAKGKHSSIIVVAEGAYPGGADTLMKAAQQI
HPFEGRVTVLGHIQRGGSPTARDRVLASRLGAAAAETLVSGSSGVMLGEVEGEIALTPLA
EAVERRKPIDRSVYDLATVLAE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcggtgtgatgaccagtgggggcgacgcccccggcatgaacgccgccctg
cgggcggtggtgcgctgggcggcggcgaacgaggtcgaggtggtgggcatccgacgcggc
tacgcggggatgatcgagggcgagttcgttccgctggcgccgcgcgacgtggccaacatc
atccagcgcggcggcacgatcttgcgtaccgcgcgcagcaaggcgttcctggagcccgag
gggcgcgccgaggcggcgcgccggctggccgaggcgaagatcgacggcctggtggccatc
ggcggcgacggcaccttccgcggcgccatcaagatgacccaggagcaccgcatccccatt
gtgggggtgccggggacgatcgacaacgacctctacggcaccgacttcaccatcggcttc
gacaccgcggtcaacaccgcgctggacgccatcgaccgcatccgcgacaccgccgccagc
cacgagcgcgtcttcttcatcgaggtgatgggccggcacgccggcttcatcgccctcgac
gtcgggctcgccggcggagccgaggtgatcgcgctgcccgagatccccaccggccccgag
gagatcgccgagcagatccggctatccgaggccaagggcaagcactcctcgatcatcgtc
gtggccgagggggcctaccccggcggcgccgacacgctgatgaaggccgcgcagcagatc
caccccttcgaggggcgggtcaccgtgctgggccacatccagcgcgggggttcgccgacc
gcgcgcgaccgggtgctggccagccgcctgggggcggcggccgccgagacgctggtttcg
ggcagcagcggggtgatgctcggggaggtcgagggcgagatcgcgctcacgccgctggcc
gaggcggtggaacggcgcaagccgatcgaccgcagcgtctacgacctggcgacggtgctg
gccgagtag

DBGET integrated database retrieval system