KEGG   Oceanithermus profundus: Ocepr_1700Help
Entry
Ocepr_1700        CDS       T01369                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
opr  Oceanithermus profundus
Pathway
opr00010  Glycolysis / Gluconeogenesis
opr00052  Galactose metabolism
opr00500  Starch and sucrose metabolism
opr00520  Amino sugar and nucleotide sugar metabolism
opr00521  Streptomycin biosynthesis
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01120  Microbial metabolism in diverse environments
opr01130  Biosynthesis of antibiotics
opr01200  Carbon metabolism
Module
opr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ocepr_1700
   00052 Galactose metabolism
    Ocepr_1700
   00500 Starch and sucrose metabolism
    Ocepr_1700
   00520 Amino sugar and nucleotide sugar metabolism
    Ocepr_1700
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ocepr_1700
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ocepr_1700
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ocepr_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA CwsA
Motif
Other DBs
NCBI-ProteinID: ADR37153
UniProt: E4U4T6
Position
complement(1714020..1714925)
Genome map
AA seq 301 aa AA seqDB search
MATLGIDLGGTKIALGVLEGGRLIQRGRITTPREGAEAVLQAMIAAANEALAEAGAPVTA
VGVGTPGPIDYERGVVVFAPNIARFRDVPLRARLEEALQRPVALENDANAAALAEHHLGA
ARGAASSFFVTVSTGIGGGLVADGRVWRGAYGQAGEFGHLTVLPGGPVCGCGNAGCLEAV
ASGRALARDASYAYAEPLDTPELFARWRAGEAKAARIVEAAADYLGQALADAQKLWDPEV
VVVGGGVALGGGEVWLERVRRAFERHAAGWRTAPLLPARLGEDAGVIGAALAARALAPEG
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgctcgggattgacctggggggcaccaagatcgccctgggggtgctcgaaggc
ggacgcctgatccaacgcggccgcatcacgaccccccgggagggtgcggaggccgtcttg
caggcgatgatcgcggcggccaacgaggcgctggccgaggccggggcgccggtgacggcc
gtgggggtgggcaccccgggccccatcgactacgagcgcggcgtcgtcgtcttcgcgccc
aacatcgcgcggttccgcgacgttcccctgcgcgcgcggcttgaggaggccttgcagcgc
cccgtggcgctcgagaacgacgccaacgccgcggcgctggccgaacaccacctgggcgcg
gcccggggcgcggcgagctcgtttttcgtgaccgtctccaccggcatcggcggcggcctg
gtggcggacggccgcgtctggcgcggcgcctacggccaggcgggcgagttcggccacctc
accgtcctgccggggggtccggtctgcggttgcggcaacgccggctgcctggaggcggtg
gcgagcgggcgggcgctggcgcgcgatgccagctacgcctacgccgaacccctggacacg
cccgaactgttcgcgcgctggcgcgccggcgaggccaaggccgcgcgcatcgtcgaggcc
gccgcggactacctgggccaggcgctcgcggacgctcagaagctgtgggatccggaggtc
gtcgtcgtcggcggtggggtggccctcggcggcggcgaggtctggctcgagcgcgtgcgc
cgggccttcgagcgccacgcggcggggtggcgcaccgccccgcttttgcctgcgcgcctg
ggcgaggacgcgggcgtgatcggcgcggcgctggcggcgcgcgcgctggctccggaaggc
ccttag

DBGET integrated database retrieval system