KEGG   Oceanithermus profundus: Ocepr_1752Help
Entry
Ocepr_1752        CDS       T01369                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
opr  Oceanithermus profundus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ocepr_1752
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ocepr_1752
   00020 Citrate cycle (TCA cycle)
    Ocepr_1752
   00620 Pyruvate metabolism
    Ocepr_1752
Enzymes [BR:opr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ocepr_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763169..1764518
Genome map
AA seq 449 aa AA seqDB search
MPKEVLLPELAESVVEGEILKWLVNEGDVVAKDQPLVEVMTDKVTVELPSPFAGVLVKKL
VGEGDVVPVETPIALIDESAEAAAAPAEAAAAAAAAVAEEEDRGERLSLFKPDKTEAEVK
NPFASGARKPAGPAVAERPRAGVNKYGRVLAVPAARQLARELGIDIAQVPGSGPNGRVRV
EDVRAYAEQAPAAPAAAAPAGFPPPVPYRTPAGYEELEERVPLRGMRRIIAQQMMASHLH
TVRTLVVDEADVTELVALRRRLKERAEEAGVKLSYVPFIFKAAVEALKKFPVVNSSLDDA
RGEMVLKKYYHLGLSVATDAGLVVPVIRDVDRKTLLELAAEIGDKVARAREGKLTPEEVS
GSSFSITSVGNLGGLFSFPIINVPDAAILGVHTIQKRPVVKGDEIVAREMLYLSLSFDHR
LVDGAEATLFLREVIARLEDPYWLMLHAV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaagtgctcctacctgaactcgccgagtccgtggtggaaggcgagatcctc
aagtggctggtcaacgagggcgacgtcgtcgccaaggaccagccgctggtggaggtgatg
accgataaggtcaccgtcgaactgcccagccccttcgcgggcgtgctggtgaagaagctc
gtcggcgagggcgacgtggttcccgtcgaaacgccgatcgcgctgatcgacgagagcgcc
gaggccgcggcggcgcccgccgaagcggcggcggccgcggccgccgcggtggccgaagaa
gaggaccgcggcgaacggctctcgctcttcaaacccgacaagaccgaagccgaggtgaag
aaccccttcgcctcgggcgcgcggaaacccgcagggcccgcggtggccgaacgcccgcgc
gccggggtgaacaagtacggccgggtgctcgcggtgcccgcggcccggcagctggcccgg
gagctgggcatcgacatcgcccaggtgccgggctccggcccgaacggccgggtgcgcgtc
gaggacgtgcgcgcctacgctgaacaggccccggcggccccggccgcggcggcgcccgcc
ggcttcccgccccccgtgccctaccgcacccccgcaggctacgaggagctggaggagcgc
gtgccgctgcggggcatgcgccgcatcatcgcccagcagatgatggccagccacctgcac
acggtgcgcaccctcgtcgtcgacgaggccgacgtcaccgagctggtcgcgttgcgccgc
cggctcaaggagcgcgccgaggaggcgggggtgaagctgagctacgtgcccttcatcttc
aaggccgcggtggaggcgctgaagaagttcccggtggtcaacagcagcctcgacgacgcc
cgcggcgaaatggtgctcaagaagtactaccacctcggcctttcggtggccaccgacgcg
gggctcgtcgtcccggtgatccgcgacgtcgatcggaagaccctcctcgagctggccgcc
gagatcggcgacaaggtagcccgcgcccgcgaaggcaagctgacgcccgaggaggtcagc
ggctccagcttctcgatcaccagcgtgggcaacctgggggggctcttctccttccccatc
atcaacgtgcccgacgccgctatcctgggcgtgcacaccatccagaaacgcccggtcgtc
aaaggcgacgagatcgtcgcccgcgagatgctctacctctcgctcagcttcgatcaccgg
ctggtggacggcgccgaggccacgctcttcctgcgcgaggtcatcgcccgcctcgaagac
ccctactggctgatgctgcacgccgtctaa

DBGET integrated database retrieval system