KEGG   Oceanithermus profundus: Ocepr_1752Help
Entry
Ocepr_1752        CDS       T01369                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
opr  Oceanithermus profundus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:opr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:opr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:opr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:opr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763169..1764518
Genome map
AA seq 449 aa AA seqDB search
MPKEVLLPELAESVVEGEILKWLVNEGDVVAKDQPLVEVMTDKVTVELPSPFAGVLVKKL
VGEGDVVPVETPIALIDESAEAAAAPAEAAAAAAAAVAEEEDRGERLSLFKPDKTEAEVK
NPFASGARKPAGPAVAERPRAGVNKYGRVLAVPAARQLARELGIDIAQVPGSGPNGRVRV
EDVRAYAEQAPAAPAAAAPAGFPPPVPYRTPAGYEELEERVPLRGMRRIIAQQMMASHLH
TVRTLVVDEADVTELVALRRRLKERAEEAGVKLSYVPFIFKAAVEALKKFPVVNSSLDDA
RGEMVLKKYYHLGLSVATDAGLVVPVIRDVDRKTLLELAAEIGDKVARAREGKLTPEEVS
GSSFSITSVGNLGGLFSFPIINVPDAAILGVHTIQKRPVVKGDEIVAREMLYLSLSFDHR
LVDGAEATLFLREVIARLEDPYWLMLHAV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaagtgctcctacctgaactcgccgagtccgtggtggaaggcgagatcctc
aagtggctggtcaacgagggcgacgtcgtcgccaaggaccagccgctggtggaggtgatg
accgataaggtcaccgtcgaactgcccagccccttcgcgggcgtgctggtgaagaagctc
gtcggcgagggcgacgtggttcccgtcgaaacgccgatcgcgctgatcgacgagagcgcc
gaggccgcggcggcgcccgccgaagcggcggcggccgcggccgccgcggtggccgaagaa
gaggaccgcggcgaacggctctcgctcttcaaacccgacaagaccgaagccgaggtgaag
aaccccttcgcctcgggcgcgcggaaacccgcagggcccgcggtggccgaacgcccgcgc
gccggggtgaacaagtacggccgggtgctcgcggtgcccgcggcccggcagctggcccgg
gagctgggcatcgacatcgcccaggtgccgggctccggcccgaacggccgggtgcgcgtc
gaggacgtgcgcgcctacgctgaacaggccccggcggccccggccgcggcggcgcccgcc
ggcttcccgccccccgtgccctaccgcacccccgcaggctacgaggagctggaggagcgc
gtgccgctgcggggcatgcgccgcatcatcgcccagcagatgatggccagccacctgcac
acggtgcgcaccctcgtcgtcgacgaggccgacgtcaccgagctggtcgcgttgcgccgc
cggctcaaggagcgcgccgaggaggcgggggtgaagctgagctacgtgcccttcatcttc
aaggccgcggtggaggcgctgaagaagttcccggtggtcaacagcagcctcgacgacgcc
cgcggcgaaatggtgctcaagaagtactaccacctcggcctttcggtggccaccgacgcg
gggctcgtcgtcccggtgatccgcgacgtcgatcggaagaccctcctcgagctggccgcc
gagatcggcgacaaggtagcccgcgcccgcgaaggcaagctgacgcccgaggaggtcagc
ggctccagcttctcgatcaccagcgtgggcaacctgggggggctcttctccttccccatc
atcaacgtgcccgacgccgctatcctgggcgtgcacaccatccagaaacgcccggtcgtc
aaaggcgacgagatcgtcgcccgcgagatgctctacctctcgctcagcttcgatcaccgg
ctggtggacggcgccgaggccacgctcttcctgcgcgaggtcatcgcccgcctcgaagac
ccctactggctgatgctgcacgccgtctaa

DBGET integrated database retrieval system