KEGG   Oceanithermus profundus: Ocepr_1771Help
Entry
Ocepr_1771        CDS       T01369                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
opr  Oceanithermus profundus
Brite
Enzymes [BR:opr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Ocepr_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADR37224
UniProt: E4U9R0
Position
1787156..1788844
Genome map
AA seq 562 aa AA seqDB search
MARLTEHLTFLYGAAAAERWAPVFTERIENFARAHPELARRPRALATSPAEAWLITYGDQ
ITREDEAPLATLARFLDRWLAPAFSGVHLLPIYPYSSDDGFSVIDYRAVDPRLGGWDHVR
ALAERYALMLDAVINHASQESAWFQGFLRCEEPYRRYFLVPPEDWDLSRVVRPRTTPLLT
EFQTACGPKRVWTTFSADQVDLNYREPEVLLEVLELLLFYAAHGARRLRLDAVGFVWKEP
GTTCLNLPQTHEVVRLFRTALDAAAPEVALVTETNVPHAENVAYFGSGEDEAQLVYNFAL
PPLVLHAFARGDARALARWAAELELPGPKAAFLNFLASHDGIGLRPVEGILPPEEVAFLV
ERTLAHGGEVSYRDTPAGPAPYELNTTWYDALNPPGTPEALGVRRLLASHAIMLALAGLP
AVYVHALFGTPNWRKGYEQSGEKRKLNRRKFREAEVEAWLTDPGSRPRRILDGLKARLTL
RAGHPAFHPAAPQRVLDLGAGVFAVERGAEGERALVAVNVTGQPQPLVLETEGWRDARTG
APAGRARVLEPYADLWLTRDEA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcctaaccgagcacctcaccttcctctacggcgccgcggcggcggagcgctgg
gcgcccgtcttcacggagcgcatcgaaaacttcgcccgcgcccatcccgaactggcccgc
aggccgcgggcgctcgccacctccccggccgaggcctggctcatcacctacggcgaccag
atcacgcgcgaggacgaggccccgctggccaccctggcgcgctttctggaccgctggctg
gcccccgcgttcagcggcgtgcacctgctgcccatctacccctactcttccgacgacggc
ttctcggtcatcgactaccgcgcggtggacccgcgcctggggggctgggaccacgtgcgc
gcgctggcggagcgctacgcgctgatgctcgacgccgtgatcaaccacgcctcgcaggaa
agcgcctggttccagggtttcttgcgctgcgaagagccttaccggcgttactttctggtg
cccccggaggactgggacctgagccgggtcgtgcgcccgcgcaccaccccgctgctcacc
gagttccagaccgcctgcgggccgaagcgggtctggaccaccttctcggccgaccaggtg
gacctcaactaccgcgagcccgaggtgctgctcgaggtgctcgagctgctgctcttctac
gccgctcacggcgcgcggcggctgcgcctcgacgcggtgggtttcgtctggaaggagccg
ggcacgacctgcctgaacctgccccagacccacgaggtcgtccggctcttccgcaccgcg
ctcgacgccgcggcccccgaggtggcgctcgtcaccgagaccaacgtgccccacgccgag
aacgtggcctacttcggcagcggcgaggacgaggcccagctcgtctacaacttcgcgctg
ccgccgctggtgctccacgccttcgcccgcggcgacgcccgtgcgcttgcgcgctgggcg
gcggagctcgagctcccgggcccgaaggcggccttcctcaacttcctggccagccacgac
ggcatcgggctgcggccggtggaggggatcttgccgccggaggaagtggccttcctggtc
gagcgcaccctcgcccacggcggcgaggtcagctaccgcgacacccccgcgggccccgcg
ccctacgagctcaacaccacctggtacgacgccctcaacccgccgggcacccccgaggcg
ctgggcgtgcggcggctgctcgccagccacgcgatcatgctggcgctcgcgggcctgccc
gcggtctacgtgcacgccctcttcggaacccccaactggcggaagggctacgaacaaagc
ggcgagaaacgcaagctcaaccgccgcaagttccgtgaggccgaggtggaggcctggctc
acggaccccggatcgcgtccgcgccgcatcctggacgggctgaaggcgcggctgaccctg
cgcgccggccaccccgccttccacccggcggcgccccagagggtgctcgacctgggcgcg
ggcgtcttcgcggtggagcgcggcgcggagggggaacgggcgctggtggcggtcaacgtc
accgggcagccccagccgctcgtgctggagacggagggctggcgcgacgcccgcaccggc
gcgcccgcgggccgcgcccgggtgctcgagccctacgccgacctctggctgacgcgggac
gaggcctga

DBGET integrated database retrieval system