KEGG   Oceanithermus profundus: Ocepr_1804Help
Entry
Ocepr_1804        CDS       T01369                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
opr  Oceanithermus profundus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:opr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1817264..1818754
Genome map
AA seq 496 aa AA seqDB search
MAYLLALDQGTTSSRAIVFDLSGRIVALAQEPFEQHFPHPGWVEHDPTEIWHTQLATARA
ALEQAGLTAGDLAAVGITNQRETVVLWERSSGRPVSRAIVWQDRRTAELTDRMKREGLEA
RVRAKTGLVLDPYFSASKLAWLLEDPGLRRRAEAGELAFGTIDSWLVWNLTGGAVHATDV
SNASRTLLFDIHAGRWDDELLELFRVPRAVLPEVRPSVGDFGVADPQWLGGPVPIHGVLG
DQQAALFGQACFEAGMAKNTYGTGAFLVMNTGTEPLQGDGVLTTVAWRVRDEPLRYALEG
SIFVAGAAVQWLRDGLGLIKESHEIEALAASVASSEGVYFVPALTGLGSPYWDPHARGLL
VGLTRGSGRAHIARATLEAIALQVYDAVHAMETAGVHLAALRADGGAAANDLLLQIQADL
LGRTVERPRVTETTALGAAMAAAVGADLADLPTLARAWQPDRRFEPAGDPEARARLIAGW
HEAVARARGWAEGAGA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtatctgttagccctcgatcaggggaccaccagttcgcgggcgatcgtcttcgac
ctcagcggtcgcatcgtcgccctggcccaggagccgttcgagcagcactttccccacccc
ggctgggtggagcacgacccgacggagatctggcacacccagctggccacggcccgggcg
gcgctggagcaggcgggcctgaccgccggggacctggccgccgtcggcatcaccaaccag
cgcgagaccgtggtgctctgggagcgcagcagcgggcgccccgtcagccgcgccatcgtc
tggcaggaccgccgcaccgccgagctgacggaccgcatgaaacgcgaggggctggaggcg
cgggtgcgggccaagaccggcctcgtcctcgacccctacttctcggcgagcaagctggcc
tggctgctcgaggacccggggctgcgccgccgcgccgaagccggcgagctggccttcggc
accatcgacagctggctcgtctggaacctgactggaggcgcggtgcacgccaccgatgtt
tccaacgcgtcgcgcaccctgctcttcgacatccacgccggccgctgggacgacgagctg
ctcgagctcttccgggtgccgcgcgccgtcctgcccgaggtgcgcccctcggtgggcgac
ttcggggtcgccgacccccagtggctgggcgggcccgtgccgatccacggggtgctcggc
gaccagcaggccgcgctcttcggccaggcctgcttcgaggctgggatggccaagaacacc
tacggcaccggcgccttcctggtgatgaacaccgggaccgagccgctccagggggacggc
gtcctcaccaccgtggcctggcgggttcgcgacgagcccctgcgctacgcgctcgagggc
tcgatcttcgtcgccggcgcggcggtgcagtggctgcgcgacgggctgggcctgatcaag
gagagccacgagatcgaggcgctggcggccagcgtggccagcagcgagggcgtctacttc
gtgcccgcgctcacggggctgggcagcccctattgggacccccacgcccgcggcctgctc
gtggggctgacccggggcagcggccgcgcccacatcgcccgggccaccctcgaggccatc
gccctgcaggtctacgacgcggtgcacgcgatggagaccgccggggtgcacctggccgcc
ctgcgcgccgacggcggggccgcggccaacgacctgctcctgcagatccaggccgacctg
ctgggccggacggtcgagcgcccgcgcgtcaccgagaccacggcgctgggcgccgccatg
gccgccgccgtgggggccgacctggcggacctgcccacgctggcgcgcgcctggcagccg
gaccggcgctttgaacccgcgggcgatccggaggcacgcgcccgcttgatcgcgggctgg
cacgaagccgtagcacgcgcccgaggctgggcggaaggagctggagcatga

DBGET integrated database retrieval system