KEGG   Oceanithermus profundus: Ocepr_2050Help
Entry
Ocepr_2050        CDS       T01369                                 

Definition
nad-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
opr  Oceanithermus profundus
Brite
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Ocepr_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2083142..2084128
Genome map
AA seq 328 aa AA seqDB search
MTYLVTGATGFIGGRLARRLLAAGHSVRVLARRPEAAASLEAAGARVHRGDLTRPETLQP
AMDGVDGVFHVAAWYAIGAPAAAAEATNVQGTRHVLEAALELGVPKVVYTSTIAVYGDTR
GRLVDEGYRYDGRRLGWASAYDRTKWLAHYEVARPLAEAGLPLVTVLPGLVYGPGDRSLI
GDLLRRLVCGRTLAVPAETVYCWSHVDDAAHAHVLAMERGHPGEEYIVAGEPRRLVAVLR
QARRWIGSSSRILPLPHAALRLLSRLARPFDARMPPVYTSEGLRVATVSYTADHAKARAE
LGYAPRPLREGLPPTLEALRDETRCATR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctcgtcaccggggccaccgggttcatcggtggccgcctggcccgccggctg
ctcgccgccggccacagcgtgcgcgtcctcgcccgccgcccggaggccgcggcctccctg
gaagccgccggcgcccgggtccaccgcggcgacctcacccggcccgaaaccctgcagccg
gccatggacggcgtggacggcgtctttcacgtcgccgcctggtacgccatcggtgccccc
gccgcggcggcggaagccacgaacgttcagggaacccggcacgtgctcgaggccgcactc
gagctgggggtgcccaaggtggtgtacacctccacgatcgccgtctacggcgacacccgc
gggcggctcgtggacgaggggtaccgctacgacgggcgccggctcggctgggccagcgcc
tacgaccgcacgaagtggctcgcccactacgaggtggcgcgccccctggccgaggccggg
ctgcccctggtcaccgtcctgccggggttggtctacggccccggcgaccgcagcctgatc
ggggacctgctgcgccggctcgtctgcggccgcacgctggcggtgccggccgagacggtc
tactgctggtcccacgtcgacgacgcggcccatgcccacgtgctggcgatggagcgcggc
cacccgggcgaagagtacatcgtggccggcgaaccccgcaggctcgtggccgtcctgcgc
caggcccgccgctggatcggctcctcctcgcgcattctgccactgccgcacgcggccctg
aggctgctgagccgcctcgcccgcccgttcgacgcccggatgcccccggtctacacctcc
gaaggcctgcgggtcgccacggtgagctacacggccgaccacgccaaggcgcgcgccgag
ctggggtacgccccgcggccgctgcgcgaggggttgccgccgaccctggaagccctgcgg
gacgaaacgcgctgcgccactcggtag

DBGET integrated database retrieval system