KEGG   Oceanithermus profundus: Ocepr_2315Help
Entry
Ocepr_2315        CDS       T01369                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
opr  Oceanithermus profundus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:opr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ocepr_2315
Enzymes [BR:opr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ocepr_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pOCEPR01:complement(56910..58730)
Genome map
AA seq 606 aa AA seqDB search
MVSEGRWKIERVVYLKDGFAVVAVRNEAGERHTAVGEMPTPVEGTWVRMETEHTVHPRYG
PRLRVVRFLGLAPPPSKELAKIEGYLKLGFSEEAASWLAARFGSRPERAFDKPQELLVPG
VPREVLRRVFPRLERLLGGLIDLLGEGHTAAPLFLLAERSGLGKEEIQELAREARKQRLI
VEEQGRYGLVQPYRTERSIADGLLFRLKPGRGLRLTPPAGHGLSDEQARIFKLVRENRVV
VLTGGPGSGKTTTIATLLAAPELHRMRFGIAAPTGKAARRIAEVARLPAETIHRLLGLGE
ARRPLYHARNPLPYDLLVIDETSMLDAEIAAFLVDALAPSTSVIFVGDPDQLPPVGPGQF
LRDLMTRVATLRLTQIFRQAQDSPIVNGAYALREGRMPLADGERLRLLPFEEEAAQTTLR
TLLDELQRLEQIVGERPQVLVPGNRGPLGVRRLSPFLQQQLNPGGKPLGPIGWGMEAREG
DPAVWIHNDYELGIMNGEVGVLRGGGSLGLTFETPTDRFAIPGNKRSRLVLAYAMTVHRS
QGSEWPAVITILPKAHMALLSRELVYTALTRSKQYHTLLFHPEALYRARAVQASRRYTWL
DVLLRG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
ttggtaagcgagggccgctggaagatcgagcgggtcgtctacctgaaagacggcttcgcc
gtcgttgcggtccgcaacgaagccggggagcgccacaccgccgtgggcgagatgcccacc
cccgtagaggggacgtgggtgcgcatggagaccgagcacacggtccacccccgatacggg
cctcggctcagggtggtgcgtttcctgggcctcgcgccgccgccctcgaaggagctcgcc
aagatcgagggctatctgaagctaggctttagcgaggaagccgcgagctggctcgcggcc
cgcttcggctcgcggccggaacgggccttcgacaagccccaagagctgctcgtgcccggg
gtgccgcgtgaagttctccggcgggtcttcccgcgcctcgagcggttgctgggtggattg
atcgacctgcttggggaaggacacacggccgctcctctttttttgctcgcggaacgcagc
ggcctcggcaaggaagagatccaggagctggcccgggaagcccgaaagcagcggctcatc
gttgaggagcaggggcgctacggcctggttcagccctaccgaaccgagcgcagcatcgcc
gacgggctcctttttcgcctgaagcccggccgcgggttgcgccttacgcctccggccggc
cacggcctctccgacgagcaggctcgcatcttcaagctggtgcgcgaaaaccgcgtggtc
gtcctcaccggtggtcccgggagcggcaagacgacgacgatcgccacgctactcgccgcc
cccgagctgcatcggatgcggttcgggatcgcggctcctaccgggaaggcggcccgtcgc
atcgccgaggtcgcgcgtctgcctgcggaaacgattcaccggctgctggggctgggggag
gcgcgccggcctctctaccacgcgcgcaaccctctgccgtacgacctgctggtgatcgac
gagacctcgatgctcgacgccgagatcgcagccttcctggtagacgcgctcgcgccgagc
acctcggtcatcttcgtcggcgaccccgaccagcttccgcccgtaggtcccgggcagttc
ctgcgcgatctgatgacccgagtggccaccttgcggctgacgcagatctttcgtcaagcg
caggacagccccatcgtgaacggggcctacgccttgcgcgagggcaggatgcccttggcc
gacggcgaacgtttgcgccttttgcctttcgaggaagaagccgcgcaaacgacgttgcgg
acgctactcgacgagctccagaggctcgagcagatcgtcggcgaacggccccaggtgcta
gtgcccgggaaccggggccccctgggggtgcgtcgcctcagccccttcctccagcagcag
ctcaatcccggggggaaaccgctggggccgatcggttggggcatggaggcccgcgaaggg
gaccccgcggtgtggatccacaacgactacgagttgggaatcatgaacggtgaggtgggg
gtgctgcggggcgggggaagcctgggcctcaccttcgaaaccccgaccgaccgcttcgcc
atccccgggaacaaacgcagccggctcgtcctcgcctacgcgatgacggtacaccggtcc
cagggctcggagtggcccgcagtcatcacgatccttcccaaggcccacatggccttgctc
tcgcgggaactcgtctacacggcgctgacgcgcagcaagcagtaccatacgctgctcttc
cacccggaggccctctaccgagcccgtgcggtgcaggcgagccggcggtacacctggttg
gacgtactcttgcggggttaa

DBGET integrated database retrieval system