KEGG   Ornithobacterium rhinotracheale: Ornrh_0038Help
Entry
Ornrh_0038        CDS       T02145                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:orh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40874..41722
Genome map
AA seq 282 aa AA seqDB search
MRIFAGVEEEYGKYETAKAVLIPVPYDGTSTWIKGADKGPDAFLDAADNMEIYDIETKSE
PYKNGIFLDEPVTEDASPEAMTDAVHARVKKYLDDDKFVTLFGGEHSISIGSIRAFGEKY
GKITVLQLDAHTDLRPEYHGSKCNHACAVFEANEKHHLVQVGIRSMDTSEVQYLKEENVF
FAHQIAENPNWIEDVFNRLGDNPVYITIDLDGFDPSICPSTGTPEPGGLPWYPTLKLLKK
VIQQKNVVGFDIVELAPNENEKSSDFLAAKLYYKMLAYQFTK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttcgcaggagtagaagaagaatatggcaaatacgaaaccgccaaagcagtg
ctaattcccgttccatacgacgggacaagtacatggattaagggagcagacaaaggacca
gatgcctttttagatgctgccgataacatggagatttacgacatcgaaaccaaatcagaa
ccctacaaaaatggaattttcctagacgagcccgtgactgaagacgcttcgccagaagcc
atgaccgatgcggtgcacgctcgagttaagaaatatttggacgatgataaattcgtaaca
ctttttggtggagagcattctatctcgatagggagtattcgtgcttttggagaaaaatat
ggcaaaatcacggttttgcaattagatgcccacaccgatttaagaccagaataccacggt
agcaaatgcaatcatgcttgtgctgtttttgaggcaaacgaaaagcatcatcttgtgcaa
gtgggaatcagaagtatggacacaagcgaagtgcagtatttaaaagaagaaaatgtattc
tttgcgcaccaaatcgctgaaaatccaaattggatcgaagatgtgttcaatcgtttgggc
gataatcctgtgtacattaccattgatttagacgggtttgatccttcgatttgcccatct
acaggaacgccagagccaggtggattgccatggtatccaactttgaaattattgaaaaaa
gtaattcagcaaaaaaatgtcgtaggttttgatattgtggaacttgctccaaacgaaaac
gagaaatcttctgatttcttagcggctaaattatattataaaatgttggcttatcaattc
acaaaataa

DBGET integrated database retrieval system