KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_0092Help
Entry
Ornrh_0092        CDS       T02145                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ornrh_0092
Enzymes [BR:orh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ornrh_0092
Peptidases [BR:orh01002]
 Cysteine Peptidases
  Family C44
   Ornrh_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93320..94990
Genome map
AA seq 556 aa AA seqDB search
MCGIVCAFDIKQSTEELRPQVLKMAKKLRHRGPDWSGIYSDKHAIMAHERLAIVDPTSGK
QPLISADGRYVLAVNGEIYNHREIRERYKDSYQFQTQSDCEVILPLFADKGAAGIDELNG
MFAFAIYDTQTQEFMVARDHMGIVPLYMGFDKQGTFYVASELKALEGHCNSIKVFLPGHY
YHSKEKKLQKWYSRDWEKYSAVEHNKSDIELLKKSLEDAVHRQLMSDVPYGVLLSGGLDS
SIISALAKKFAAKRIESDDKEQAWYPQLHSFAVGLEGSPDLAAARKVADHIGTIHHEIKF
TIQEGLDAVRDVIYYLETYDITTVRASTPMYLMARVIKSMGIKMVLSGEGSDEIFGGYLY
FHKAPNAREFHEESVRKLENLYKYDCLRANKSLMAWGIEGRVPFLDKEFLDVAMRINPED
KMITPEKMEKWILRKAFEDYLPAEVVWRQKEQFSDGVGYSWIDKLKELVNAKVSDEELKN
AHHRFPVQTPTSKEEYYYRSIFEEHFPSDAAALTVPSVPSVACSTPTALKWDKSFQNLND
PSGRAVAKVHADAYVK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtatgtgcttttgatattaaacaaagcaccgaggaactaagacctcaa
gtattaaaaatggctaaaaaacttcgtcatcgtggtccagattggagtggaatttatagc
gacaaacacgccatcatggcgcatgagcgtttggcgattgtagatcctacttcgggcaag
caacccctaatcagtgcagatggcagatatgtgcttgccgtaaatggtgaaatctacaac
cacagagaaatccgtgaacgctacaaagattcgtatcaatttcaaacccagtcggattgc
gaggtgattctgccactatttgcagacaaaggtgctgcgggaatcgatgaactaaacgga
atgtttgcttttgcaatttatgatacacaaacacaggagtttatggtagcgcgcgaccat
atgggaattgtgccactgtacatgggatttgacaagcaaggaactttttatgtagcttcg
gaattaaaggcactagaggggcattgcaactcaatcaaggtgtttttgccagggcattac
taccacagcaaagagaaaaaactgcaaaaatggtattctcgcgattgggaaaaatattcg
gcagtggagcataacaagtccgatattgagttattgaaaaaatctttggaagatgcagtg
caccgccaattaatgtctgatgtgccttatggcgtattgctttcaggcggattagattct
tcgattatttcagcattggctaaaaaatttgcggctaaacgcattgagtctgatgacaaa
gaacaagcatggtacccgcaattgcactcatttgccgtaggattagaaggttctccagat
ttggctgcggctcgcaaagttgccgaccacatcgggacaattcatcacgaaatcaaattc
acgattcaggaaggtttagacgctgtgcgcgatgtgatttattatctcgaaacttatgac
attaccaccgttcgtgcctctactccgatgtatcttatggcaagagtgattaagtctatg
ggaatcaaaatggtgctttcgggcgaaggttcagacgaaatttttggtggctatttatat
ttccacaaagcaccaaacgccagagagtttcacgaagaaagcgtgcgcaaattagaaaac
ttgtataaatacgattgtttgcgtgccaataaatctttgatggcatggggaatcgaagga
cgagtgccttttttggacaaagaatttttggatgttgctatgcgtattaatccagaagat
aaaatgattacgccagaaaaaatggaaaaatggattttgcgcaaagcctttgaggattat
ttaccagctgaggtagtatggagacaaaaagagcaattttccgatggagtgggctactct
tggatcgataaattaaaagaattggtaaacgccaaagtttcagacgaggagttgaaaaat
gcacatcaccgcttcccagtgcaaacgcctactagcaaggaggagtattactatcgtagc
atttttgaagagcatttcccatcagatgcagcagcactcactgtgccatctgtgccatcg
gttgcatgtagcacgcctacagctctgaaatgggataaatccttccaaaacttaaacgac
ccaagcggtagagccgtagcaaaagtgcatgcagatgcttatgtgaaatag

DBGET integrated database retrieval system