KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_0095Help
Entry
Ornrh_0095        CDS       T02145                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00010  Glycolysis / Gluconeogenesis
orh00052  Galactose metabolism
orh00500  Starch and sucrose metabolism
orh00520  Amino sugar and nucleotide sugar metabolism
orh00521  Streptomycin biosynthesis
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01120  Microbial metabolism in diverse environments
orh01130  Biosynthesis of antibiotics
orh01200  Carbon metabolism
Module
orh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ornrh_0095
   00052 Galactose metabolism
    Ornrh_0095
   00500 Starch and sucrose metabolism
    Ornrh_0095
   00520 Amino sugar and nucleotide sugar metabolism
    Ornrh_0095
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ornrh_0095
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ornrh_0095
Enzymes [BR:orh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ornrh_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N RuvC
Motif
Other DBs
NCBI-ProteinID: AFL96324
UniProt: I3ZX90
Position
96452..97378
Genome map
AA seq 308 aa AA seqDB search
MALTNLSKQFALGIDIGGTNTKYGLVSQRGEILVKGSLKTKDYPVIEDYIQALYDEIYPI
IQEHKKDSVFAGIGVGAPNANYFKGTIENATNLAWKGIVPFASLMEEKFDAPCRITNDAN
AAAMGEMMYGAARGMKDFIMITLGTGVGSGIVCGGQLIYGHDGFAGELGHTIVKPNGRKH
WGTGIAITAKKMRAEFPESMLNQYKEDEINAKTVHDCAEKGDPVAIEVFRYTGQRLGEAL
ANFVMFSSPEAILLFGGVVKAGDFLLKPARLHMERNLLPGFRGKVKLVVSELDEADAAIL
GASALVWA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcattaacaaatttatctaagcaattcgctttaggaatagacataggaggaacaaat
accaaatacggattggtgagccaaagaggagaaattttggtaaaaggatcattgaaaacc
aaagattatcccgtgattgaagactatattcaagcactttatgatgaaatttacccaatc
attcaagaacataaaaaagacagcgtttttgcaggaataggcgttggtgcaccgaatgct
aattactttaaaggtactatcgaaaacgcaaccaaccttgcttggaaaggaattgttcca
tttgcttcgcttatggaagaaaaattcgacgcaccttgtagaattaccaatgatgccaac
gcggcagctatgggagaaatgatgtatggcgcggctcgtggtatgaaagattttatcatg
atcacattaggtacaggtgtaggtagtggaatcgtttgtggcggacaattaatctatggt
cacgatggttttgcgggagaattgggacacaccattgtaaaaccaaacggtagaaaacac
tggggcacaggtatcgcaattactgcaaagaaaatgcgtgcagaatttccagaatctatg
ctaaaccaatataaagaagacgaaatcaatgctaaaactgtgcacgattgtgccgaaaaa
ggcgaccctgttgcaattgaagtattccgctatacaggtcagcgtttgggagaagcattg
gcaaacttcgtaatgttctcatctccagaagctattttgcttttcggtggagttgtgaaa
gctggggatttcttgctaaaacctgctagattacacatggagcgcaacttattgccagga
tttagaggcaaagtaaaactcgttgtgagtgagcttgacgaagccgatgcagcaatttta
ggagcaagtgcacttgtttgggcataa

DBGET integrated database retrieval system