KEGG   Ornithobacterium rhinotracheale: Ornrh_0095Help
Entry
Ornrh_0095        CDS       T02145                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ornrh_0095
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ornrh_0095
   00052 Galactose metabolism
    Ornrh_0095
   00500 Starch and sucrose metabolism
    Ornrh_0095
   00520 Amino sugar and nucleotide sugar metabolism
    Ornrh_0095
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ornrh_0095
   00524 Butirosin and neomycin biosynthesis
    Ornrh_0095
Enzymes [BR:orh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ornrh_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96452..97378
Genome map
AA seq 308 aa AA seqDB search
MALTNLSKQFALGIDIGGTNTKYGLVSQRGEILVKGSLKTKDYPVIEDYIQALYDEIYPI
IQEHKKDSVFAGIGVGAPNANYFKGTIENATNLAWKGIVPFASLMEEKFDAPCRITNDAN
AAAMGEMMYGAARGMKDFIMITLGTGVGSGIVCGGQLIYGHDGFAGELGHTIVKPNGRKH
WGTGIAITAKKMRAEFPESMLNQYKEDEINAKTVHDCAEKGDPVAIEVFRYTGQRLGEAL
ANFVMFSSPEAILLFGGVVKAGDFLLKPARLHMERNLLPGFRGKVKLVVSELDEADAAIL
GASALVWA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcattaacaaatttatctaagcaattcgctttaggaatagacataggaggaacaaat
accaaatacggattggtgagccaaagaggagaaattttggtaaaaggatcattgaaaacc
aaagattatcccgtgattgaagactatattcaagcactttatgatgaaatttacccaatc
attcaagaacataaaaaagacagcgtttttgcaggaataggcgttggtgcaccgaatgct
aattactttaaaggtactatcgaaaacgcaaccaaccttgcttggaaaggaattgttcca
tttgcttcgcttatggaagaaaaattcgacgcaccttgtagaattaccaatgatgccaac
gcggcagctatgggagaaatgatgtatggcgcggctcgtggtatgaaagattttatcatg
atcacattaggtacaggtgtaggtagtggaatcgtttgtggcggacaattaatctatggt
cacgatggttttgcgggagaattgggacacaccattgtaaaaccaaacggtagaaaacac
tggggcacaggtatcgcaattactgcaaagaaaatgcgtgcagaatttccagaatctatg
ctaaaccaatataaagaagacgaaatcaatgctaaaactgtgcacgattgtgccgaaaaa
ggcgaccctgttgcaattgaagtattccgctatacaggtcagcgtttgggagaagcattg
gcaaacttcgtaatgttctcatctccagaagctattttgcttttcggtggagttgtgaaa
gctggggatttcttgctaaaacctgctagattacacatggagcgcaacttattgccagga
tttagaggcaaagtaaaactcgttgtgagtgagcttgacgaagccgatgcagcaatttta
ggagcaagtgcacttgtttgggcataa

DBGET integrated database retrieval system