KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_0193Help
Entry
Ornrh_0193        CDS       T02145                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00010  Glycolysis / Gluconeogenesis
orh00030  Pentose phosphate pathway
orh00051  Fructose and mannose metabolism
orh00052  Galactose metabolism
orh00680  Methane metabolism
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01120  Microbial metabolism in diverse environments
orh01130  Biosynthesis of antibiotics
orh01200  Carbon metabolism
orh01230  Biosynthesis of amino acids
orh03018  RNA degradation
Module
orh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ornrh_0193
   00030 Pentose phosphate pathway
    Ornrh_0193
   00051 Fructose and mannose metabolism
    Ornrh_0193
   00052 Galactose metabolism
    Ornrh_0193
  Energy metabolism
   00680 Methane metabolism
    Ornrh_0193
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ornrh_0193
Enzymes [BR:orh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ornrh_0193
Protein phosphatases and associated proteins [BR:orh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ornrh_0193
Messenger RNA biogenesis [BR:orh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ornrh_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFL96415
UniProt: I3ZXI1
Position
complement(196158..197144)
Genome map
AA seq 328 aa AA seqDB search
MATKKINTIGVITSGGDAPGMNAALRAVVRAASYHGLNVKGVRLGYEGLITNDVVSLGPR
SVSNIINRGGTILKTARSDEFRTVEGRKKAFENVQKNGIDALVVIGGDGSFTGAKLFHEE
HGIPVIGVPGTIDNDIFGTDYTIGYDTALNTAVDAIDKIRDTAQSHNRVFFVEVMGRDAG
FIALNSGIAAGAQDILIPEKRDEIDEMFNALDRGEQTGKISSIIVVAEGEELGNIYDLAK
FTKIKYPTYDIRVTVLGHIQRGGTPSCADRVLASRLGIAAVEGLLAGKSNVMAGVRSNKI
VYTPIEEAIQKHNEIDHELIRVSEILAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaaaaaatcaacacaataggtgtaattacttctgggggagatgctcctgga
atgaacgccgctctgcgtgcggtagtacgagctgcatcttaccatgggctaaatgtgaaa
ggagtgcgtttaggctatgagggattgattacaaatgatgtagtttcattaggacctaga
agtgtaagtaatattattaatagaggtggtacaattttaaaaactgcccgttcagatgaa
tttagaactgtagaaggtcgtaaaaaagcctttgaaaacgtacaaaaaaatggaattgat
gcccttgtggtaatcgggggagatggttcttttacgggagctaaattattccacgaagag
catggaatccctgtaattggagtgcctggaacgattgataacgatatcttcggtacagat
tacacaatcggttacgatacagcacttaacaccgctgttgatgcgatagataaaattaga
gatacagcacaatcacacaaccgtgtcttctttgttgaggtaatggggcgtgatgcaggt
tttattgctctaaatagtggtatcgcagctggcgcacaagatatcttgattccagaaaaa
agagatgaaatcgatgaaatgtttaacgcgctagatcgtggtgaacaaacaggtaaaatc
tcaagcattattgttgtggcagagggcgaggagctaggtaacatttatgatttggctaaa
tttaccaaaattaagtacccaacttatgatatccgtgttacggtgctaggacacattcag
cgaggaggaactccaagctgtgcagatcgtgtgttggcaagccgtttaggtatcgctgca
gttgaggggcttttagctggaaaaagcaatgtaatggcaggagtaagaagcaataagatc
gtatatactcctatcgaagaagctatccaaaaacacaacgaaatcgatcatgaattaatt
agagtgtctgaaattttggcacgataa

DBGET integrated database retrieval system