KEGG   Ornithobacterium rhinotracheale: Ornrh_0231Help
Entry
Ornrh_0231        CDS       T02145                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
orh  Ornithobacterium rhinotracheale
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239204..239854
Genome map
AA seq 216 aa AA seqDB search
MEETFKHKGLRKKLIDLLRAKGINDESVLDAMNKIPRHLFIDSAFEAHAYEDKAFPIAAG
QTISHPFTVAFQSSLLQIQPGDKILEVGTGSGYQTSVLVAMGAEVYTIERQKTLVDFSRN
ILSKIGFSPKYQTFGDGYRGMPTFAPFDKIIVTAGAPFLPKKLLRQLKIGGLAVIPIGDK
QQKMYTFLRVSDKKFEQMSFGDYRFVPMLEKKDIAD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttggaagagacttttaaacacaagggactgagaaaaaaattgattgatttactgagagcc
aaagggataaatgacgaatcggtgctcgatgcgatgaataaaatacctagacacttgttt
atagattctgcttttgaggcgcatgcttacgaagataaggcgtttcctatcgctgcggga
caaacgatttctcaccctttcacggtggcttttcaatcatcgttactacaaattcagcca
ggcgacaagattttggaagtaggcactgggagcgggtaccaaacttcggttttagtagcc
atgggagccgaagtctataccattgaaagacagaaaactttggtcgatttttcaagaaat
attttaagcaaaataggttttagtcctaaatatcaaacctttggagacggatatagaggc
atgcctacttttgctccgtttgataaaatcattgtaacagcgggagctccttttttacct
aaaaaattacttaggcaattaaagattggaggcttagcggtgattcctatcggagacaaa
cagcagaaaatgtacactttcttgcgcgtgtccgacaagaaatttgaacaaatgagtttt
ggggattatcgatttgttcctatgttagaaaaaaaggatatagccgattaa

DBGET integrated database retrieval system