KEGG   Ornithobacterium rhinotracheale: Ornrh_0266Help
Entry
Ornrh_0266        CDS       T02145                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:orh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:orh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:orh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281313..282527
Genome map
AA seq 404 aa AA seqDB search
MKKLIFALCFIQSLLLSAQTETPPMGFMTWNYFGVDFNENDIKSLADDLVSTGLRDLGYD
YIFIDDGWQGGRDNRNNIIPDPQKFPSGIKALADYVHSKGLKIGIYSDAAPLTCAGYTAS
LNFEEQDAKTFADWGIDYLKYDYCGAPADSVTAKKRYKKMSDALKKTNRNIVFSICEWGD
RKPWHWAKNAGGTLWRTSADIRDKWKATEPYTTPEELHRWGAGILDILNINAPLDEFAGN
GYWNDPDMLVAGLYGKKGAPSTELNGHGCTDTEYQSQMSLWSLMASPLMISLDLKSMTPK
TKEILMNPDVIAIDQDALGKQAKRVIFTEKLQVFVKSLANGDVAIGVLNTEDKKAKVNLD
LTKIGVKSYRQAKDLWSKKSFKIRGNSISLNIQPHETILLRLSK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttatttttgcactttgttttatacagagcctcttgctttcggctcaaacc
gaaacgcctcccatgggctttatgacatggaactactttggtgtggatttcaacgaaaat
gacattaaatctcttgccgatgacttggtaagtactgggctcagagatttgggctacgat
tacatctttatagacgatggctggcagggcggacgagataacagaaacaacattattccc
gatccgcagaaattcccctctggcatcaaagcacttgccgattatgtgcattcaaaaggc
ttaaaaataggaatttattccgatgcggctcccctcacttgcgcgggctatactgcgagt
ttaaattttgaagagcaagatgccaaaacctttgccgattggggaattgattatctaaaa
tatgactattgtggtgctccagctgacagcgtaacggcaaaaaaacgctacaaaaaaatg
agcgatgcactcaagaaaaccaacagaaatatagttttcagcatttgcgaatggggcgat
cgcaagccatggcactgggctaaaaacgcaggcggaaccctttggcgcacatcggcagac
attcgcgataaatggaaagccaccgagccctacaccacgcccgaagaattgcaccgctgg
ggggcaggaattttagatattttaaacatcaacgctccgcttgatgagtttgcgggcaac
ggctactggaacgaccccgatatgctcgtggctgggctttatggcaaaaaaggtgcaccg
tctacggagctaaacggacatggctgtaccgacacagaataccaatcacaaatgagccta
tggagtttgatggcttcgcctctgatgatttctctggacttaaaaagcatgacgcctaaa
accaaggaaatattaatgaatcccgatgttatcgccatcgaccaagatgcacttggcaaa
caagctaaaagagtgatttttaccgaaaaattacaagtttttgtaaagtccttggctaat
ggagatgttgcgataggcgtgcttaataccgaagataaaaaggcaaaagtaaaccttgat
ttaactaaaatcggggtaaaatcttatcgccaagccaaagatttatggtctaaaaaatct
tttaaaattcgtggaaatagcatttcgctcaatatccaacctcatgaaactattttgctt
cgtttgagcaaataa

DBGET integrated database retrieval system