KEGG   Ornithobacterium rhinotracheale: Ornrh_0266Help
Entry
Ornrh_0266        CDS       T02145                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ornrh_0266
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ornrh_0266
   00600 Sphingolipid metabolism
    Ornrh_0266
Enzymes [BR:orh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ornrh_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281313..282527
Genome map
AA seq 404 aa AA seqDB search
MKKLIFALCFIQSLLLSAQTETPPMGFMTWNYFGVDFNENDIKSLADDLVSTGLRDLGYD
YIFIDDGWQGGRDNRNNIIPDPQKFPSGIKALADYVHSKGLKIGIYSDAAPLTCAGYTAS
LNFEEQDAKTFADWGIDYLKYDYCGAPADSVTAKKRYKKMSDALKKTNRNIVFSICEWGD
RKPWHWAKNAGGTLWRTSADIRDKWKATEPYTTPEELHRWGAGILDILNINAPLDEFAGN
GYWNDPDMLVAGLYGKKGAPSTELNGHGCTDTEYQSQMSLWSLMASPLMISLDLKSMTPK
TKEILMNPDVIAIDQDALGKQAKRVIFTEKLQVFVKSLANGDVAIGVLNTEDKKAKVNLD
LTKIGVKSYRQAKDLWSKKSFKIRGNSISLNIQPHETILLRLSK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttatttttgcactttgttttatacagagcctcttgctttcggctcaaacc
gaaacgcctcccatgggctttatgacatggaactactttggtgtggatttcaacgaaaat
gacattaaatctcttgccgatgacttggtaagtactgggctcagagatttgggctacgat
tacatctttatagacgatggctggcagggcggacgagataacagaaacaacattattccc
gatccgcagaaattcccctctggcatcaaagcacttgccgattatgtgcattcaaaaggc
ttaaaaataggaatttattccgatgcggctcccctcacttgcgcgggctatactgcgagt
ttaaattttgaagagcaagatgccaaaacctttgccgattggggaattgattatctaaaa
tatgactattgtggtgctccagctgacagcgtaacggcaaaaaaacgctacaaaaaaatg
agcgatgcactcaagaaaaccaacagaaatatagttttcagcatttgcgaatggggcgat
cgcaagccatggcactgggctaaaaacgcaggcggaaccctttggcgcacatcggcagac
attcgcgataaatggaaagccaccgagccctacaccacgcccgaagaattgcaccgctgg
ggggcaggaattttagatattttaaacatcaacgctccgcttgatgagtttgcgggcaac
ggctactggaacgaccccgatatgctcgtggctgggctttatggcaaaaaaggtgcaccg
tctacggagctaaacggacatggctgtaccgacacagaataccaatcacaaatgagccta
tggagtttgatggcttcgcctctgatgatttctctggacttaaaaagcatgacgcctaaa
accaaggaaatattaatgaatcccgatgttatcgccatcgaccaagatgcacttggcaaa
caagctaaaagagtgatttttaccgaaaaattacaagtttttgtaaagtccttggctaat
ggagatgttgcgataggcgtgcttaataccgaagataaaaaggcaaaagtaaaccttgat
ttaactaaaatcggggtaaaatcttatcgccaagccaaagatttatggtctaaaaaatct
tttaaaattcgtggaaatagcatttcgctcaatatccaacctcatgaaactattttgctt
cgtttgagcaaataa

DBGET integrated database retrieval system