KEGG   Ornithobacterium rhinotracheale: Ornrh_0580Help
Entry
Ornrh_0580        CDS       T02145                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ornrh_0580
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ornrh_0580
Enzymes [BR:orh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ornrh_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600579..602039
Genome map
AA seq 486 aa AA seqDB search
MRLEQLTYQLPILASFGEMAKEVRGIQFDSRKVEQDDVFVAIVGSLSDGHKFIDSAIEKG
AKTIICQNLPEDLKPEITYIQVKNTSISLGKLAANFYDNPSEKIKLVGITGTNGKTTTSS
LLYSLGELLGYPCALISTIEIKIHKNSIPSERTTPDILKINEILAQAVEEGCEYAFMEVS
SHGIDQHRIEGLKFSGAGFTNITHDHLDYHKTFKNYLEVKKRFFDDLPKSAFAITNLDDK
NGEIMLQNTKSKKLGYALKTEAPYKAKVIENQLTGMLLTFNNREVWTSLVGNFNAYNLLL
VYAIAVELGWNKDEVLVGISQLKNVNGRFQTFQSKGNITIIVDYAHTPDALENVISTIQK
IRTKNENLICVAGCGGDRDKSKRPEMGDAVSELADLAILTSDNPRSEDPEVILAEMEAGV
QPQNFRKYLKITDRKEAIKTAINMAESGDIVLIAGKGHETYQEIKGVKHPFDDVLIAKEF
TEILNK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagattagaacaactcacatatcagctaccgattttagccagctttggagagatggct
aaagaagttcgtggcattcagtttgactctagaaaagtagagcaagacgatgtttttgtc
gctatcgtggggagcttatcagacggacacaaattcatcgacagcgcgatcgaaaaaggg
gcaaaaaccataatttgccaaaatttacccgaagacttaaaaccagaaatcacttatatt
caagttaaaaacacttcgattagtttagggaaattggcagctaatttctatgacaatcct
tccgaaaaaattaaattagtaggcattacaggtactaatggaaaaaccaccacatcaagc
ctactttactctttgggagaattgcttggctacccgtgtgctttgatttctaccatagaa
atcaaaatccacaaaaatagcattccgagcgaacgcacaacgccagatattttaaaaatc
aatgagattttggcacaagcggtagaagaaggttgcgaatacgcctttatggaagtgagc
tctcacggcattgatcaacacaggattgaggggctaaagttcagcggagcgggctttacc
aacattacacacgatcatttagactatcataaaacttttaaaaattatctagaggtaaaa
aaacgcttttttgatgatttgccaaaatctgcttttgccatcaccaatctcgatgacaaa
aacggagaaatcatgctccaaaacaccaagtctaaaaagcttggctacgcactcaaaaca
gaagctccatacaaagctaaagtaattgaaaaccaacttacgggaatgctcctcactttt
aacaacagagaagtctggacatcgctcgttggaaacttcaatgcatataatctgttgcta
gtttatgcaattgccgtagagcttggctggaataaagatgaagttttagtaggcataagc
caacttaaaaatgtaaacggaagattccaaacatttcaatcaaaaggcaatattaccatt
atcgtagattacgcccacacgccagacgctctggaaaatgtaatcagcacgattcagaaa
attcgtaccaaaaacgaaaatttgatttgcgtggctggctgcggtggagatcgcgacaaa
agcaaacgacctgaaatgggcgatgccgtgtctgaattggcagatttagccattttaacc
tcggacaacccacgaagcgaagaccctgaggtgattttagccgaaatggaagcgggcgtt
cagccacagaactttagaaaatatttaaaaatcacggacagaaaagaggctataaaaacg
gcgattaacatggctgaaagtggagacattgttctaatcgcaggcaaagggcacgaaacc
tatcaagaaattaaaggggtaaaacatccttttgacgatgttttaattgcaaaagaattc
actgaaattttaaataaatag

DBGET integrated database retrieval system