KEGG   Ornithobacterium rhinotracheale: Ornrh_0725Help
Entry
Ornrh_0725        CDS       T02145                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:orh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(750335..750985)
Genome map
AA seq 216 aa AA seqDB search
MNFNAVCQEFHTLAENFRHTLHMITQLKGRLVEKEPNYVVIDCHGVGYYVSISQATYNDL
PADENVLLYTHLLVREDAQNLYGFSTKSERSVFEFLISVSGVGPASAVVMLSTLSVGDIY
AAIANDQPEVLQSVKGIGAKTAQRIILDLKNKIKKQVLETKKIEGKGTSKIKIEALSALE
VLGIPKKVAEPIIVQLLKENPTLSLENLIKQTLKKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttaatgcagtttgccaagaatttcataccttagccgaaaattttagacataca
ctacacatgattacgcaactcaaaggcagattagtagagaaagaacccaattatgtggtg
atagattgccatggtgtgggatactatgtaagcattagtcaagcaacttacaatgatttg
ccagcagatgagaatgtattattgtacacccaccttttggtgcgagaagatgcacagaat
ttatatggatttagtacgaaatcagagcgttcagtatttgaatttttaatttcggtgagt
ggagtgggacccgcctctgccgttgtgatgttgtctacactttcggtgggagatatttac
gctgcaattgctaacgatcagccagaggttttgcagtcggtaaagggaattggagctaaa
acagcacagcgtatcattttagatcttaaaaataagattaaaaaacaagtgctggaaact
aaaaagatagaaggtaaaggcacaagcaaaattaaaatcgaggctctttctgcccttgaa
gtcttggggattcctaaaaaagtggcagagcctatcattgttcagcttttgaaagaaaat
ccaactttaagcttagaaaacttaatcaaacaaaccttgaaaaagaaatag

DBGET integrated database retrieval system