KEGG   Ornithobacterium rhinotracheale: Ornrh_0866Help
Entry
Ornrh_0866        CDS       T02145                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ornrh_0866
Enzymes [BR:orh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ornrh_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(900915..901334)
Genome map
AA seq 139 aa AA seqDB search
MKSKVVLLLGTNLGDRSRNLIQAKEHLSEIGEIFQETSVMETAPVGFTAEQDFYNQVLVF
YTELSPVALLKALKVIEKKMGRVYTKPLSGEKYVSRIIDIDILFYENLKFSSKVLILPHE
QVKSRKFVHELLKNSEVIN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtaaagttgttttacttttagggacaaatttgggagatcgttcgcgaaattta
atccaagccaaagaacatttatcagaaattggtgagatttttcaagaaacatctgttatg
gagaccgctcctgttggttttacggcagagcaggatttctataatcaagttttggtgttt
tatacagaattgtcgcccgttgctttattgaaggctttgaaagtaattgagaaaaaaatg
gggagggtttatactaaacctctgagcggagaaaaatatgtttcgcgtatcatagatatt
gacatactattttatgaaaatttaaagttttcttctaaagtgttgattttgcctcatgag
caggtaaagtctagaaaatttgttcatgagttgttgaaaaatagtgaggtaattaattaa

DBGET integrated database retrieval system