KEGG   Ornithobacterium rhinotracheale: Ornrh_0884Help
Entry
Ornrh_0884        CDS       T02145                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Ornrh_0884
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ornrh_0884
Enzymes [BR:orh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Ornrh_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921172..921723
Genome map
AA seq 183 aa AA seqDB search
MTVKETEIQDCFLIQPQIFGDERGYFFESYNQEKFNQETGLNVRFVQDNQSFSTYGVIRG
LHIQMGEFAQAKLVRVVHGKVLDVAVDARKDSPTFGKIVCAELSAENQSQLFIPRGCLHG
FSILSENAIFQYKCDNYYNQKSESGVFFNDPTLNINWQIERNSVICSTKDKSLPLWEEFL
AKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaagaaactgaaattcaggattgttttttgatacaaccgcaaattttcgga
gatgaacgcggctactttttcgaaagctacaaccaggaaaaatttaaccaagaaacaggg
ctaaatgttcgctttgtgcaagacaatcagtctttttccacttacggtgtcatccgtggg
ctacacattcaaatgggcgaatttgcacaggccaaactcgtgcgtgtggtacatggaaaa
gtgctagatgtagcagtagatgcacgcaaggattctcctactttcgggaaaatcgtttgt
gccgaactttcagctgaaaatcaatcgcaattattcattcctagaggatgtttacacgga
ttttcaatattgtctgaaaatgcaatttttcaatataaatgcgacaattattataatcaa
aaatcagaatctggcgtattttttaacgacccaactttaaacatcaattggcaaattgaa
agaaattccgtaatttgttctactaaagacaaatctctcccactttgggaagaattttta
gccaaattatag

DBGET integrated database retrieval system