KEGG   Ornithobacterium rhinotracheale: Ornrh_0884Help
Entry
Ornrh_0884        CDS       T02145                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:orh00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:orh00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921172..921723
Genome map
AA seq 183 aa AA seqDB search
MTVKETEIQDCFLIQPQIFGDERGYFFESYNQEKFNQETGLNVRFVQDNQSFSTYGVIRG
LHIQMGEFAQAKLVRVVHGKVLDVAVDARKDSPTFGKIVCAELSAENQSQLFIPRGCLHG
FSILSENAIFQYKCDNYYNQKSESGVFFNDPTLNINWQIERNSVICSTKDKSLPLWEEFL
AKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaagaaactgaaattcaggattgttttttgatacaaccgcaaattttcgga
gatgaacgcggctactttttcgaaagctacaaccaggaaaaatttaaccaagaaacaggg
ctaaatgttcgctttgtgcaagacaatcagtctttttccacttacggtgtcatccgtggg
ctacacattcaaatgggcgaatttgcacaggccaaactcgtgcgtgtggtacatggaaaa
gtgctagatgtagcagtagatgcacgcaaggattctcctactttcgggaaaatcgtttgt
gccgaactttcagctgaaaatcaatcgcaattattcattcctagaggatgtttacacgga
ttttcaatattgtctgaaaatgcaatttttcaatataaatgcgacaattattataatcaa
aaatcagaatctggcgtattttttaacgacccaactttaaacatcaattggcaaattgaa
agaaattccgtaatttgttctactaaagacaaatctctcccactttgggaagaattttta
gccaaattatag

DBGET integrated database retrieval system